(data stored in ACNUC7421 zone)

EMBL: CP000529.PE236

CP000529.PE236       Location/Qualifiers
FT   CDS_pept        243786..244055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0238"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphocarrier HPr protein; KEGG: pol:Bpro_0298 HPrNtr"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35563"
FT                   /db_xref="GOA:A1VIT5"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIT5"
FT                   /protein_id="ABM35563.1"
FT                   /translation="MIKTRTTISNKLGLHARASAKFTKLAGSFRSEVWMSKGERRVNAK
FT                   SIMGVMMLAAGMGSSVEIETDGADEQAAMDALLALVADKFGEGE"
     atgatcaaga cccggaccac catcagcaat aagctgggcc tgcacgccag agcttcggcc        60
     aaattcacca agctcgctgg cagctttcgc agcgaagtgt ggatgagcaa gggcgagcgc       120
     cgcgtcaacg ccaaaagcat catgggcgtg atgatgctgg cagccggcat gggcagcagc       180
     gttgaaatcg aaaccgatgg cgccgatgag caggcggcca tggacgcctt gctggcgctg       240
     gttgccgaca agttcgggga aggggaatga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page