(data stored in ACNUC7421 zone)

EMBL: CP000529.PE238

CP000529.PE238       Location/Qualifiers
FT   CDS_pept        complement(246138..246980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0240"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: pol:Bpro_0311 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35565"
FT                   /db_xref="GOA:A1VIT7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIT7"
FT                   /protein_id="ABM35565.1"
FT                   /translation="MPANLYALGAIALWITLAALGVSLRHIPPFLLTGIALLMGSLLAL
FT                   PAVLQDRKAWSVPAKTLALGVYGLFGFHFLLFIALRHAPPVEANLVNYLWPLFMVVLAP
FT                   LFLAGLKLRAVHVAAALLGFAGAAIAILSASSNATGAVGWSWGFLPALASAFIWASYSL
FT                   LTQRVKPFPTAAIGLFGLVSGLLSLLCHWALEPQAVLSARDWLLLAVMGWGPLGTAFFL
FT                   WDKALKLGDARQIGILSYITPLGSTALLMLVSGRPLSWSIGLAAVMIIGAAVLGTRVK"
     atgccagcca atttatatgc cctgggcgcc atcgcgctgt ggatcaccct tgccgccctc        60
     ggcgtgtcgc tcaggcacat tccacctttt ttgctgaccg gcattgccct gctcatgggc       120
     agcctgctgg cgctgccggc cgtgctgcaa gaccgcaagg cctggagcgt tcccgccaaa       180
     accctcgcgc tgggcgttta cggcctgttc ggatttcatt tcctgctgtt catcgccctg       240
     cgccatgcac cgccggtcga ggccaacctg gtcaactacc tctggccgct gttcatggtg       300
     gtgctggcgc cgctgtttct ggccgggctc aagctgcgcg ccgtgcatgt ggctgcggcg       360
     ctgctgggat ttgccggagc ggccatcgcc atcctgagcg ccagcagcaa cgccacgggc       420
     gccgtgggct ggtcgtgggg gtttctaccg gcgctggcgt cggccttcat ctgggccagc       480
     tattcactgc tgacccagcg cgtcaaaccg ttcccgacgg cggccatcgg gctgttcggg       540
     ctggtgtctg gcctgctgtc gctgctgtgc cactgggcgc tggagcccca ggccgtgctg       600
     tcggcgcgcg actggctgct gctggccgtg atgggctggg ggccgctggg caccgcgttt       660
     ttcctctggg acaaggctct caagctcggc gacgcgcggc agatcggcat cctgagctac       720
     atcacgccgc tgggctccac cgccctcctg atgctggtga gcggccgccc cttgagctgg       780
     agcattggcc tagcggccgt gatgatcatt ggcgcggcgg tgctgggtac acgggtgaaa       840
     tga                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page