(data stored in ACNUC7421 zone)

EMBL: CP000529.PE239

CP000529.PE239       Location/Qualifiers
FT   CDS_pept        247236..247424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35566"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIT8"
FT                   /protein_id="ABM35566.1"
FT                   /translation="MKILAAIVLVLTSLTGCVAYPVPYDNGPPQGHYGGPHRGQGDRDG
FT                   DGVRNRDDRRPNNPYRY"
     atgaaaatac tcgcagcaat cgtgctggta ctgaccagcc tgacaggttg tgtcgcctac        60
     ccggtccctt atgacaacgg cccgccccaa ggccactatg gcggaccgca ccggggccag       120
     ggcgaccgcg atggcgacgg ggtacgcaac cgcgacgacc gccgcccgaa caatccctac       180
     cgttattga                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page