(data stored in ACNUC7421 zone)

EMBL: CP000529.PE242

CP000529.PE242       Location/Qualifiers
FT   CDS_pept        complement(249304..250065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0244"
FT                   /product="yecA family protein"
FT                   /note="TIGRFAM: yecA family protein; PFAM: SEC-C motif
FT                   domain protein; KEGG: xcv:XCVb0013 putative metal-binding
FT                   protein, sec-C motif"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35569"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIU1"
FT                   /protein_id="ABM35569.1"
FT                   /translation="MNDFFDYNLRHPLPQQSPRLTEADHDELFKLFGDASLPAATMPAE
FT                   MADGYLTACVVGPVPVPAHEWMEAIFGQPTLPVCADPERQHRLLQLLLQRHRDIAVATA
FT                   VALHDLTPDQLFVPLTSEVDAGERITPYQIDENGNRQGDWDCKDWAEGFRLAMLDHPQW
FT                   DGLTNNPKNFDLLAPIALFAEGYNPDQPELQIDEKANLPALLSLSIYNIRSFWKLHKQT
FT                   HAPALREARKVGRNDPCPCGSGKKYKKCCGA"
     atgaacgact ttttcgacta caacctgcgc catccgctgc cgcagcaaag cccgcgcctg        60
     accgaagcgg accacgacga gctgttcaag ctgtttggcg acgccagcct gccagccgcc       120
     acgatgccgg ccgagatggc ggacggctac ctgaccgcct gcgtcgtcgg ccctgtgccg       180
     gtgcccgccc acgaatggat ggaggccatt ttcggccagc ccacgctgcc ggtttgcgcc       240
     gacccagagc gccagcaccg cctgctgcag ttgctgctgc agcggcaccg ggacatcgcg       300
     gtggccacgg cggtggcact gcacgacctc acgcccgacc agcttttcgt gccattgacc       360
     agcgaagtgg acgccgggga acgcatcacc ccgtaccaga tcgacgaaaa cggaaaccgc       420
     cagggcgact gggattgcaa ggactgggcc gaaggctttc ggctcgccat gctggaccac       480
     ccacaatggg acggcctgac gaacaacccc aaaaactttg acctgcttgc gccgattgcg       540
     ttgttcgcgg aaggttacaa ccccgaccaa cccgaactgc agattgatga aaaagccaat       600
     ctgccggcct tgttgtccct gtccatctac aacatccgaa gtttctggaa gctccacaaa       660
     caaacgcacg cgcctgcatt gcgcgaagcc cgcaaggtgg ggcgcaacga cccctgccct       720
     tgcggcagcg gcaagaaata caaaaagtgc tgcggcgcct ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page