(data stored in ACNUC7421 zone)

EMBL: CP000529.PE243

CP000529.PE243       Location/Qualifiers
FT   CDS_pept        complement(250139..250450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0245"
FT                   /product="protein of unknown function DUF493"
FT                   /note="PFAM: protein of unknown function DUF493; KEGG:
FT                   pol:Bpro_0316 protein of unknown function DUF493"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35570"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIU2"
FT                   /protein_id="ABM35570.1"
FT                   /translation="MSADNDNTPPNPPEAEARKDSLIEYPSLFPIKVMGIKAEGYVHAI
FT                   THIAHQFDPTFDAATIELRESKGGKYLGVTITVTATSREQLDELYRTLSTHPMVKVVL"
     atgagcgccg acaacgacaa cacgcccccc aacccgccag aagccgaagc ccgcaaggac        60
     tcgctgattg aatacccgtc gctgttcccc atcaaggtca tgggcatcaa ggccgagggt       120
     tatgtccacg cgatcaccca tatcgcccac cagttcgacc cgacctttga cgccgccacc       180
     atcgagctgc gcgaaagcaa gggcggcaag tacctgggcg tgaccatcac cgtgacggcc       240
     accagccgcg agcagctcga tgagctgtac cgcacgctgt ccacgcaccc gatggtcaag       300
     gtcgtgctgt ag                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page