(data stored in ACNUC7421 zone)

EMBL: CP000529.PE249

CP000529.PE249       Location/Qualifiers
FT   CDS_pept        253991..254461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0251"
FT                   /product="ATP synthase F0, B subunit"
FT                   /note="TIGRFAM: ATP synthase F0, B subunit; PFAM:
FT                   H+-transporting two-sector ATPase, B/B' subunit; KEGG:
FT                   rfr:Rfer_0110 ATP synthase F0, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35576"
FT                   /db_xref="GOA:A1VIU8"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIU8"
FT                   /protein_id="ABM35576.1"
FT                   /translation="MNINSTLFLQAVVFAILVWFTMKFVWPPITKALDERAQKIADGLA
FT                   AADKAKSELSSANKRVEAELATSRTETATRLADADRRGQGIIEDAKARAVEEANKIIAA
FT                   AQAEAAQQSVKAREALREQVALLAVKGAEQILRKEVNAGVHADLLSRLKTEL"
     gtgaacatta actccaccct gttcctgcag gctgtcgttt ttgcgatcct ggtctggttc        60
     acgatgaagt tcgtgtggcc accaatcaca aaagcgctgg acgagcgggc acagaaaatc       120
     gctgacggcc ttgctgccgc cgacaaagcc aaatccgaac tctccagcgc caacaagcgc       180
     gtggaagcag agttggccac gtcgcgcacc gagaccgcta cccgtctggc agatgcagac       240
     cgccgcggcc aaggcatcat tgaagatgcc aaagcccgcg cggttgaaga agccaacaag       300
     atcattgctg cagcccaggc tgaagcggct caacaatcgg tcaaggcccg cgaggcgttg       360
     cgcgagcagg ttgccctgct ggcggtcaag ggcgccgagc agattctccg caaggaagtc       420
     aatgccgggg ttcatgccga tttgctgagc cgcctgaaga ccgagctgta a                471
//

If you have problems or comments...

PBIL Back to PBIL home page