(data stored in ACNUC7421 zone)

EMBL: CP000529.PE25

CP000529.PE25        Location/Qualifiers
FT   CDS_pept        complement(23632..24183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35352"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI74"
FT                   /protein_id="ABM35352.1"
FT                   /translation="MLENTFINRVLHKTLWAVLLPACMLWSAAVASRQPDVLRPTPKIA
FT                   SELPAQWQGRALRPLALSEVEQRFARNFPGTLSRMTDGRQVLVLRSINQPTRMLHPAID
FT                   CYQGLGYRIAAQQLELDSERRLWRCFEALQPGGGQRLRVCERIVDAGGQGFTDTSAWYW
FT                   AAIMGQSPGPWQAITVARPL"
     gtgcttgaaa acaccttcat caaccgcgtg ctgcacaaga cgctgtgggc cgtgctgctg        60
     cccgcctgca tgctgtggtc cgccgccgtc gccagccgcc agccggacgt actgcggccc       120
     acgccgaaaa tcgccagcga actgcccgcg cagtggcagg gccgggcgct gcggccgctg       180
     gcgctcagcg aagtcgagca gcgctttgcc cgcaatttcc ccggcacgct gagccgcatg       240
     accgacggcc ggcaggtgct ggtgctgcgc agcatcaacc agccgacgcg catgctgcac       300
     ccggccatcg actgctacca ggggctgggc taccgcatcg cggcgcagca gctcgaactc       360
     gacagcgaac gcaggctgtg gcgctgcttc gaagccctgc agcccggcgg cggccagcgc       420
     ctgcgggtct gcgagcgcat cgttgatgcc ggcggccagg gcttcaccga cacctcggcc       480
     tggtactggg ccgccatcat gggccagtcg ccggggccgt ggcaggcgat caccgtggcg       540
     aggccgctgt ga                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page