(data stored in ACNUC7421 zone)

EMBL: CP000529.PE255

CP000529.PE255       Location/Qualifiers
FT   CDS_pept        complement(259641..260171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0257"
FT                   /product="protein of unknown function DUF477"
FT                   /note="PFAM: protein of unknown function DUF477; KEGG:
FT                   pol:Bpro_0329 protein of unknown function DUF477"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35582"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIV4"
FT                   /protein_id="ABM35582.1"
FT                   /translation="MNKLTLLLKHLWLDAADSRRAIPSDLAHRLAERVAASEQRHSGQI
FT                   RICVEAALPASYLWRMDDKNTLGDLIRQRAVMMFSKLRVWDTEHNNGVLIYVLLAEHAI
FT                   EIVADRGLMRHVDATHWQSVVAHMASAFREKRYEDGLTQALEEASTLLVAHFARTDASA
FT                   RHPNELPDTPLLQ"
     atgaacaagc tcacactcct gctcaagcac ctgtggctgg acgcagccga cagccggcgc        60
     gccattccct ccgacctagc gcatcgcctg gccgagcggg tcgcggccag cgagcagcgc       120
     cacagcgggc agatccgcat ctgcgtcgag gctgcactgc ctgccagtta tttatggcgg       180
     atggacgata aaaataccct gggcgacctg atccggcagc gggccgtcat gatgttcagc       240
     aagctgcgcg tctgggacac cgaacacaac aacggcgtgc tgatctacgt gctgctggcc       300
     gaacacgcga ttgaaatcgt cgccgaccgg gggctgatgc gccatgtgga cgcgacacat       360
     tggcagtccg tggtggcgca catggccagc gcctttcggg aaaaacgcta tgaagacggg       420
     ctgacgcagg cgctggaaga agcctcgacg ctgctggtgg cgcattttgc gcggacggat       480
     gcgtcagcca ggcaccccaa cgaactgccc gacacgccgc tgctgcagta a                531
//

If you have problems or comments...

PBIL Back to PBIL home page