(data stored in ACNUC7421 zone)

EMBL: CP000529.PE256

CP000529.PE256       Location/Qualifiers
FT   CDS_pept        complement(260180..261112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0258"
FT                   /product="protein of unknown function DUF477"
FT                   /note="PFAM: protein of unknown function DUF477; KEGG:
FT                   pol:Bpro_0330 protein of unknown function DUF477"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35583"
FT                   /db_xref="GOA:A1VIV5"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIV5"
FT                   /protein_id="ABM35583.1"
FT                   /translation="MTLRIFLQALLLAVWLPLASVAAWAQGVQPVPPLTAHVMDSTGTL
FT                   TAAQKAALEARLTAFEQSRGAQVVVLMVPTTQPEDIAAYAQRIGDSWKIGRKSIGDGLL
FT                   LVVAKNDRAVRIETTKALEGAIPDLAASQIIETAITPRFKQGDFAGGLDAGASQIMARI
FT                   TGENLPAPQQGQTHRGSGGGFDWTTLAVFLFFAVPIGGRVLSSVLGRKLGSVATGGAVG
FT                   VLAWVFTSSLVIGAIAAVVGMVFALISGISGLGGMGRGGRSSGWGGPGGFGGGGFGGGS
FT                   FGGSRGGGGGGFSSGGGGNFGGGGASGNW"
     atgactttgc gtatcttctt gcaggcactg ttactggcgg tatggctacc cttggccagc        60
     gtcgcggcct gggcgcaagg cgttcagccc gtcccgccgc tgaccgcgca tgtgatggac       120
     agcaccggca cgctgacggc ggcgcaaaag gccgcgctgg aagccaggct gacggccttc       180
     gagcagtcgc gcggcgccca ggtggtcgtg ctgatggtgc cgaccaccca acccgaggac       240
     attgccgcgt atgcgcagcg catcggcgac agctggaaaa tcggccgcaa gagcattggc       300
     gacggcctgc tgctggtggt ggccaagaac gaccgcgccg ttcgcattga aaccaccaag       360
     gcgctcgaag gcgccattcc cgacctggcg gcaagccaga tcatagagac cgcgatcacg       420
     ccgcgcttca agcagggcga ctttgccggc ggactggacg ccggcgccag ccagatcatg       480
     gcgcgcatca ccggcgaaaa cctgccggcg ccgcagcagg gacaaaccca tcgcggcagc       540
     ggcggcggat tcgactggac gacgctggcg gtgttcctgt tttttgccgt gcccatcggc       600
     ggccgggtgc tgtcaagtgt gctgggccgc aagctgggct cggtggcaac tggcggcgcg       660
     gtgggcgtgc tggcctgggt gttcaccagc agcctggtca tcggcgccat tgccgcagtg       720
     gtcggcatgg tgttcgcgct gatctccggc atcagcggct tgggcggcat gggccgtggc       780
     ggtcgctcgt caggctgggg cggccccgga ggcttcggcg gtggtggttt tggtggcggc       840
     agttttggtg gcagtcgtgg cggcggcggg ggtggcttca gcagcggcgg cggcggcaat       900
     ttcggtggcg gcggcgcatc gggcaactgg taa                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page