(data stored in ACNUC7421 zone)

EMBL: CP000529.PE257

CP000529.PE257       Location/Qualifiers
FT   CDS_pept        complement(261125..261724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0259"
FT                   /product="LemA family protein"
FT                   /note="PFAM: LemA family protein; KEGG: pol:Bpro_0331 LemA"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35584"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIV6"
FT                   /protein_id="ABM35584.1"
FT                   /translation="MASSLLRLSFIALLGLLLSGCGYNQFQSLDEQTKSAWSEVLNQYQ
FT                   RRADLVPNIVATVKGEAAFEQDTLTKVIEARAKATSIQVTPETLNDPAAFSKFQAAQGE
FT                   LGSALSRLMVVSERYPDLKANQAFRDLRVQLEGTENRITVARNRYIQTVQEYNVLARSF
FT                   PNNLTAMIFGYKVKPNFAVANEAQISVPPVVDFNKK"
     atggcatcga gcttattacg cttatctttc atcgccctgc tgggtctact cctttcgggc        60
     tgcggctaca accagttcca gagcctggac gagcagacca aatcggcttg gtccgaggtg       120
     ctgaaccagt accagcgccg cgccgacctg gtgcccaata tcgtggccac ggtcaagggc       180
     gaagccgctt tcgagcagga cacgctgacg aaggtgattg aagcgcgcgc caaggccacc       240
     tcgatccagg tcacgcccga aaccctgaac gacccggcgg ccttcagcaa attccaggcc       300
     gcgcagggcg aactgggcag cgccctgagc cgcctgatgg tggtcagcga acgctacccg       360
     gacctgaagg cgaaccaggc tttccgcgat ttgcgggtgc aactcgaagg caccgaaaac       420
     cgcatcaccg tggcgcgcaa ccgctacatc cagacggtgc aggagtacaa cgtgctggcg       480
     cgcagctttc caaacaacct gaccgcaatg atttttggct acaaggtcaa gcccaacttc       540
     gcggtcgcca acgaagcgca gatttccgtg ccgccggtgg ttgatttcaa caagaaataa       600
//

If you have problems or comments...

PBIL Back to PBIL home page