(data stored in ACNUC7421 zone)

EMBL: CP000529.PE258

CP000529.PE258       Location/Qualifiers
FT   CDS_pept        261839..262285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0260"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0333 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35585"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIV7"
FT                   /protein_id="ABM35585.1"
FT                   /translation="MRKPQAPPGSPENADATEAAFYDALQSGDIEKLMACWSDEDDIVC
FT                   VHPGGARLLGLAAIRGAFDTMFANGAIRAQPLKVRRLQSLGASMHSLLERIEVLTEDGP
FT                   RHAYVVATNVYHLTAQGWRMVAHHASPGTLPELQEASQTPFTLH"
     atgcgaaaac ctcaagcgcc gcctggcagc cccgaaaacg ccgatgcgac cgaagcggcg        60
     ttttacgatg cgctgcaaag cggcgatatc gaaaaactca tggcctgctg gagcgatgaa       120
     gacgatatcg tgtgcgtgca tcccggcggt gcccggctgc tcggcctcgc cgccatacgc       180
     ggcgcgtttg acaccatgtt cgccaacggc gccattcgtg cgcagccgct caaggtgcgc       240
     aggctgcagt cgctgggcgc cagcatgcac agcttgctgg agcgcatcga agtgctgacc       300
     gaagacgggc cgcgccatgc ctatgtcgtc gccaccaatg tgtaccacct gacggcgcaa       360
     ggctggcgca tggtggcgca tcacgccagc cctggaaccc tgcccgagtt gcaggaagcg       420
     tcgcaaactc ccttcaccct gcactga                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page