(data stored in ACNUC7421 zone)

EMBL: CP000529.PE259

CP000529.PE259       Location/Qualifiers
FT   CDS_pept        262290..263309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0261"
FT                   /product="hydrolase of the alpha/beta-hydrolase fold-like
FT                   protein"
FT                   /note="KEGG: pol:Bpro_0334 hydrolase of the
FT                   alpha/beta-hydrolase fold-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35586"
FT                   /db_xref="GOA:A1VIV8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIV8"
FT                   /protein_id="ABM35586.1"
FT                   /translation="MAMNYGAPWWLPDGNTQTIWAALRARRFMGPPPVFRRERWSTPDD
FT                   DFVDVDWLMPRFESAGLAERGAVREAPSVGVPLLVLFHGLEGSSSSHYAQAFADVAGSR
FT                   GWACAVPHFRGCSGEPNLAPRAYHSGDFAEIDWMLRRFAGLNQGPVVAVGISLGGNALM
FT                   RWAGEMGTQAGQVVTAVAAVCAPLDLTASGQAIGQGFNRQVYTRMFLKSMVPKALQKLA
FT                   QHPGLFDRDTLLAARDLHAFDNVFTGPVHGFKGVDDYWSRASAKPHLGRIAVPALALNA
FT                   LNDPFIPAASLPQSADVSPWVTLWQPAQGGHVGFPASNFPAHVRAMPEAVAGFLAAQL"
     atggccatga attacggcgc cccctggtgg ttacccgatg gcaatacgca gaccatctgg        60
     gccgccctgc gcgcgcgccg cttcatgggg ccgccgcccg tgtttcgccg cgaacgctgg       120
     agtacgccgg atgacgactt tgtcgatgtg gactggctga tgccacggtt tgaaagcgca       180
     ggcctggccg agcgcggggc agttcgtgaa gcgccaagcg tgggggtgcc tctgctggtg       240
     ctgtttcacg gacttgaagg ctcgtcgtcc agccactatg cccaggcctt tgccgacgtc       300
     gccggcagcc ggggctgggc ctgcgccgtg ccgcactttc gcggctgttc cggcgagccc       360
     aacctggcgc cgcgtgccta ccactcgggc gattttgctg aaatcgactg gatgctcagg       420
     cgttttgccg gcctgaacca ggggccggtc gtggccgtcg gaatctccct gggtggcaat       480
     gcgctgatgc gctgggccgg cgagatgggc acgcaggccg ggcaggtggt gacggcggtg       540
     gcggcggtct gcgcgccgct tgatctgacg gccagcggcc aggccatcgg ccagggcttc       600
     aaccgtcagg tgtacacccg catgttcctc aaatccatgg tgcccaaggc gctgcaaaaa       660
     ctggcgcagc atcccggcct gttcgaccgc gacaccttgc tggcggcacg cgacctgcat       720
     gcgttcgaca atgtctttac cgggccggtg cacgggttca agggcgttga cgattactgg       780
     tcgcgcgcgt cggccaaacc tcatctgggc cggattgccg tgcctgcgct cgcactgaac       840
     gccttgaacg atcccttcat tcccgcagca agcctgccgc agtctgccga tgtcagcccc       900
     tgggtcacct tgtggcagcc ggcgcagggc ggccatgtcg gctttcccgc atcgaatttt       960
     ccggcgcatg tgcgcgccat gcctgaagcg gtggcgggct ttctggcggc gcagctttag      1020
//

If you have problems or comments...

PBIL Back to PBIL home page