(data stored in ACNUC7421 zone)

EMBL: CP000529.PE26

CP000529.PE26        Location/Qualifiers
FT   CDS_pept        complement(24208..25053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0027"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_06497 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35353"
FT                   /db_xref="GOA:A1VI75"
FT                   /db_xref="InterPro:IPR019127"
FT                   /db_xref="InterPro:IPR026392"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI75"
FT                   /protein_id="ABM35353.1"
FT                   /translation="MGAGGGQTPAIRLFQARFPSLPASSGFVRWGVRIDTAPGWLWPLL
FT                   LVAALWPTWLWMGRRMLDRSDDPLGLLALAALGLLVACHRLRLRSSPRLAWFALALAGA
FT                   VAATAAQGLLPALAVALLALLALAAGLAAFLPAGVASAPVVGLSVLALPLLASLQFYAG
FT                   FPLRLITAEASRWLLLASHEVERSGASLRVDGHLVIVDAPCSGVQMAWLGYFTACAVTL
FT                   YLGRGNRAFLTRLPAVGVLVLAGNIVRNTLLVAAEASGNHLSGWAAWWRWRPSAARLPL
FT                   "
     atgggggccg gcggtggtca aacgccagcg atccgccttt tccaagcccg gttccccagt        60
     ctgcccgcat cgtccggctt cgtgcgctgg ggcgtgcgca tcgacaccgc gcccggctgg       120
     ctctggccgc tgctgctggt cgcggccctc tggccgacct ggctgtggat gggcaggcgc       180
     atgctggacc gctccgacga cccgctgggc ctgctggcgc tggcggcgct cgggctgctg       240
     gtggcgtgcc accggctgcg gctgcgctcg tcaccgcgat tggcctggtt tgcgctggcg       300
     ctggccggcg ccgttgccgc caccgccgcg cagggcctgc taccggcgct ggccgtggcg       360
     ctgctggccc tcttggcgct ggccgccggg ctggccgctt ttttaccggc gggcgtggcc       420
     agcgcgccgg tcgtcggcct gtcggtgctg gcgctgccgc tgctggcgtc gctgcagttc       480
     tacgcgggct ttccgctgcg cctcatcacg gccgaagcca gccgctggct gctgctggcc       540
     agccacgaag tcgagcgcag cggcgccagc ctgcgcgtgg acggccatct ggtcatcgtc       600
     gatgcgccct gctcgggcgt gcagatggcc tggctgggct acttcacggc ctgcgcggtg       660
     acgctgtacc tggggcgcgg caaccgcgct tttctaaccc gcctgcccgc cgtcggcgtg       720
     ctggtgctgg cgggcaacat cgttcgcaac acgctgctgg tggccgccga ggcctcgggt       780
     aatcacctgt ccggctgggc ggcttggtgg cgctggcggc cgtctgcggc gcgattgccc       840
     ttgtga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page