(data stored in ACNUC7421 zone)

EMBL: CP000529.PE262

CP000529.PE262       Location/Qualifiers
FT   CDS_pept        complement(265468..265785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0264"
FT                   /product="High potential iron-sulfur protein"
FT                   /note="PFAM: High potential iron-sulfur protein; KEGG:
FT                   bxe:Bxe_A4333 putative high potential iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35589"
FT                   /db_xref="GOA:A1VIW1"
FT                   /db_xref="InterPro:IPR000170"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036369"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIW1"
FT                   /protein_id="ABM35589.1"
FT                   /translation="MKSNRRTFVIQSVMSAGILATTRLAQAQAPAPLVQDSDPQAVALG
FT                   YKSDATKADKAKYPKYAAGQQCANCALYQGKPTDAAGACPLFAGKQVGAKAWCSAWAKK
FT                   A"
     atgaaatcga accgtagaac ctttgtcatt caatccgtca tgagcgcggg tattctggcc        60
     acgacacgtc tggcccaagc gcaagccccg gcaccgctgg tgcaggatag cgacccgcag       120
     gccgttgcgc tgggctacaa gagcgacgcc accaaagccg acaaggccaa atacccaaaa       180
     tacgccgccg gccagcaatg cgccaattgc gcgctttacc aaggcaagcc gaccgatgca       240
     gcgggtgctt gtccgctgtt tgccggcaag caggtcgggg ctaaagcctg gtgcagcgcc       300
     tgggccaaga aggcctga                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page