(data stored in ACNUC7421 zone)

EMBL: CP000529.PE263

CP000529.PE263       Location/Qualifiers
FT   CDS_pept        266396..267367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0265"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   pol:Bpro_0596 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35590"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIW2"
FT                   /protein_id="ABM35590.1"
FT                   /translation="MKRHFLRTIPALIALSVSPLFAAAQAAWPAKPITLVSPYAPGGTT
FT                   DLLARLLASKLQGVLGQTVIVENKGGAGGNIGTDYVSKSKPDGYTFLVASSGPLVIAPS
FT                   LYPKLPYQPNLDFTPVAPLASAAFVIAVNPGSGLTSVKDIIAKAKAGNLSFASAGSGTP
FT                   QHIIGEMFNVQAGVKIQHIPYKGSGPAMNDLVGGQVPMTFENPVPIMPQVKAGKLKVLA
FT                   VTSAKRSAAFPDIPTVSELGLKGFDAQPWYGVLGPAGVPAEVVERMNKEIRTILASTDV
FT                   KARLFALGAEPMDMTPSAFKSFIAADTKKWTAVVKASGATVD"
     atgaagagac atttcctgcg caccattcca gcgctgattg ccctgtcggt ttcgccgctg        60
     ttcgcggcag cgcaggctgc ttggccggcc aagcccatca cgctggtgtc tccttatgcc       120
     ccgggcggca ccaccgacct gctggcgcgc ctgctggcgt ccaagctgca aggcgtgctt       180
     ggccagaccg tcatcgtcga gaacaagggc ggcgcgggcg gcaacatcgg caccgactat       240
     gtgtccaagt ccaaaccgga cggctacacg tttttggtgg cgtcgagcgg tccgctggta       300
     attgcgcctt cgctctatcc gaaactgccc taccagccca acctggattt cacgccggtc       360
     gcgccgctgg ccagtgccgc cttcgtgatc gccgtcaatc ccggctcggg attgaccagc       420
     gtcaaggaca tcatcgccaa ggccaaggcc ggcaacctgt cctttgcgtc ggcaggctcg       480
     ggcacgccgc agcacatcat cggtgaaatg ttcaatgtcc aggcgggcgt gaagatccag       540
     cacattccgt acaaaggctc gggtccggcg atgaacgacc tggtgggtgg ccaggttccc       600
     atgacgttcg agaaccccgt tcccatcatg ccgcaggtca aggcgggcaa gctcaaggtg       660
     ctggcggtga ccagcgccaa acgctcggcg gcgttccccg acattccgac cgtctcggaa       720
     ctggggctca agggctttga tgcacagccc tggtatggcg ttcttggccc ggccggcgtt       780
     cctgcggaag tcgttgagcg gatgaacaaa gagatccgca ccattctggc ttccaccgat       840
     gtcaaggcgc gcctgtttgc cctgggcgcc gagccgatgg acatgacacc gtccgcattc       900
     aagagtttca ttgcggcgga caccaaaaaa tggactgccg tggtcaaggc ttccggcgcc       960
     acggtggact ga                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page