(data stored in ACNUC7421 zone)

EMBL: CP000529.PE27

CP000529.PE27        Location/Qualifiers
FT   CDS_pept        complement(25129..27234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0028"
FT                   /product="Vault protein inter-alpha-trypsin domain protein"
FT                   /note="PFAM: von Willebrand factor, type A; Vault protein
FT                   inter-alpha-trypsin domain protein; SMART: Vault protein
FT                   inter-alpha-trypsin, metazoa; KEGG: sat:SYN_02036 von
FT                   Willebrand factor type A like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35354"
FT                   /db_xref="GOA:A1VI76"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR013694"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI76"
FT                   /protein_id="ABM35354.1"
FT                   /translation="MESPLSPNARAARWLWLATASLATVCFIALSASPAQAQDNGSAPR
FT                   LKTESPYFFVKSDTPGVDALPLKSTSVDVQISGVIADVTVTQRYKNEGQRAIEARYVFP
FT                   ASTRAAVYGMNVRLADRLITANIREKQQARIEYDAARNEGKTAALLEQHLPNVFEMNVA
FT                   NILPGDDVKVELRYTELLVPQSGAYQFVFPTVVGPRYNSAQSSQALAQWVAQPFLPAGQ
FT                   ASATAFDIKVKLATPIGIKEVSSHSHSIDVTKDGDERAAVSLRSGDKPGNNRDFILDYR
FT                   LAGERIESGVMLYQGTPGNGASGENFFLAMIEPPKQVAAQAISPRDYIFVVDISGSMHG
FT                   FPLDTAKTLMRELIGKLRPSDTFNVLLFSGSNRFLSPASVPATQANIEQAVRTIDEMGG
FT                   GGGTELIPALKRVYAEPKAADVSRTVVVVTDGFVTVEREAFELVRRNLSQANLFSFGIG
FT                   SSVNRHLMEGLARAGMGEPFIITEPSQARAQAERFRRLIESPVLTSVKLRFEGLDVYDV
FT                   EPAQLPDVLGERPVVVFGKWRGTPAGQVIIDGQSATGPYRNAVTVPAQNGQNTAALRYL
FT                   WARHRIASLSDQEALEGGDAHRQRITELGLQYNLLTQYTSFLAVDQVVRNLQPQDATGV
FT                   NQPSPLPQGVSNLAVGEVSIGAAVPGTPEPATWGAVLVLLSVLALLARRERRASRGRPG
FT                   SAARFTA"
     atggagtcac cactttcccc caatgcccgc gccgcgcgct ggctctggct tgccaccgcc        60
     agcctggcga cggtctgttt catcgcgctg tcggccagcc ccgcgcaggc gcaggacaac       120
     ggcagcgcgc cccggctgaa aaccgaaagc ccgtacttct tcgtcaagag cgacacgccc       180
     ggcgtggacg cgctgccgct caaatccacc tcggtcgatg tgcagatttc cggcgtgatt       240
     gccgatgtca ccgtcaccca gcgctacaaa aacgaaggcc agcgcgccat cgaggcgcgc       300
     tatgtctttc ccgcctcgac gcgcgccgcc gtctatggca tgaacgtgcg gctggccgac       360
     cgcctgatca ccgccaacat ccgcgaaaag cagcaggcgc gcatcgaata cgacgccgcc       420
     aggaacgaag gcaagaccgc cgcgctgctg gagcagcacc tgcccaacgt gttcgagatg       480
     aacgtcgcca acatcctgcc cggcgacgac gtgaaggtgg aattgcgcta caccgaactg       540
     ttggtgccgc agtcgggcgc ttaccagttc gtctttccca cggtggtcgg cccgcgctac       600
     aacagcgcgc aatccagcca ggcgctggct caatgggtag cccagccctt cttgccagcg       660
     ggtcaggcgt cggcgacggc gtttgacatc aaggtcaagc tggccacgcc catcggcatc       720
     aaggaagtgt cttcccactc gcacagcatc gacgtgacca aggacggcga cgaacgcgcc       780
     gccgtttcct tgcgcagcgg cgataagccc ggcaacaacc gcgacttcat cctcgactac       840
     cggctggccg gcgagcgcat cgagtcgggc gtgatgctgt atcagggcac gccgggcaat       900
     ggcgccagcg gcgagaactt cttcctcgcc atgatcgagc cgcccaagca ggtcgcggcg       960
     caggccatca gcccacgcga ctacatcttc gtcgtcgata tctcgggctc gatgcacggc      1020
     tttccgctcg acacggccaa gaccttgatg cgcgagctga tcggcaagct gcgccccagc      1080
     gacaccttca acgtgctgct gttctcgggc agcaaccgct tcctgagccc cgcatcggtc      1140
     cccgccacgc aggccaatat cgagcaggcg gtgcgcacca tcgacgaaat gggcggcggt      1200
     ggcggcaccg aactgattcc ggcgctcaag cgcgtgtatg ccgaacccaa ggcggccgac      1260
     gtgtcgcgca ccgtggtcgt ggtgaccgac ggcttcgtca ccgtcgagcg cgaagccttc      1320
     gagctggtgc ggcgcaacct gtcgcaggcg aacctgtttt cattcggcat cggctcgtcg      1380
     gtcaaccgcc acctgatgga aggcctggcg cgcgccggca tgggcgagcc cttcatcatc      1440
     accgagccat cgcaggccag ggcccaggcc gagcgctttc gccggctgat cgagtcgccg      1500
     gtgctgacca gcgtgaagct gcgcttcgag ggcctggacg tgtatgacgt ggagcccgcg      1560
     caactgcccg acgtgctggg cgagcgcccg gtggtggtgt ttggcaaatg gcgcggcacg      1620
     ccagcgggcc aggtcatcat cgacggccag agcgccaccg gcccgtaccg caatgccgtg      1680
     accgtgccag cgcaaaacgg ccagaacacg gccgcgctgc gctacctttg ggcacgccac      1740
     cgcatcgcca gcctgtcgga ccaggaagcg ctcgaaggcg gcgacgcgca ccgccagcgc      1800
     atcaccgagc tgggcctgca gtacaacctg ctgacgcagt acaccagctt cctggcggtg      1860
     gaccaggtgg tgcgcaacct gcagccgcag gacgctaccg gcgtgaacca gccttcgccg      1920
     ctgccgcagg gcgtgagcaa cctggcggtg ggcgaagtgt ccatcggcgc cgcagtgccc      1980
     ggcacgcccg agcccgccac ctggggcgcg gtgctggtgc tgctgtcggt gctggccctg      2040
     ctggcgcggc gcgagcgcag ggcgtcgcgc ggcaggccgg gtagcgccgc ccgcttcacc      2100
     gcctga                                                                 2106
//

If you have problems or comments...

PBIL Back to PBIL home page