(data stored in ACNUC7421 zone)

EMBL: CP000529.PE273

CP000529.PE273       Location/Qualifiers
FT   CDS_pept        275673..276632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0276"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   bte:BTH_II0087 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35600"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIX2"
FT                   /protein_id="ABM35600.1"
FT                   /translation="MRKDKHLPSQPKGVYRVKNWPEYNAGLIERGNVSIWMDEEMFAPM
FT                   AGASVQRGRPQAYCDAVIQMLLALKSVYRLPLRALQGFAMSLRRLALPALPVPNYSTLS
FT                   RRAKALRVTLPVLRNAGEAVHLLVDSTGLKLFGEGEWKVRKHGYAKRRSWRKVHLGMDD
FT                   ETGQVCAVLMTHKDVIDASVLPELLAQIPQETKIEVVIGDGAYDTKAARAAIAGCGALA
FT                   VIPPVEGAVHWPASQAGAPERNEAIDHIAQSSKQDWKDKSGYHRRSLVENLMYRFKVLT
FT                   GDRLWARDVDVQDAEVAVRVGIINRMLVLARPKSVRIA"
     atgcgaaaag acaagcacct gcccagccag cccaaggggg tctaccgggt caagaactgg        60
     cccgagtaca acgcgggcct gattgagcgg ggcaatgtga gcatctggat ggacgaagag       120
     atgttcgcac caatggctgg ggcgtcagtt cagcgcgggc gcccgcaggc ttactgcgat       180
     gcagtgattc agatgctgct ggccctcaag tcggtgtacc gcctgccgct gcgggcattg       240
     caggggtttg ccatgagcct gcgccgcctg gcgctgccgg ccttgccagt gcccaactac       300
     agcacgctga gccgaagggc caaggcgctg cgggtaacct tgccggtgct gcgcaacgca       360
     ggcgaggctg tgcatctgct ggtggacagc acggggttga agctgtttgg cgagggcgaa       420
     tggaaggtgc gtaaacacgg ctacgccaag cgccgcagct ggcgcaaagt gcatctgggc       480
     atggatgacg agacggggca ggtgtgcgcc gtgttgatga cgcacaagga tgtgattgat       540
     gccagtgtgc tgccggagtt actggcgcaa atcccccaag aaacgaagat tgaagtggtt       600
     atcggcgatg gtgcctacga tacaaaggcc gcccgtgcgg ccattgccgg gtgcggcgcg       660
     ttggcggtca ttccccccgt ggagggcgcc gtgcactggc ctgccagcca ggctggggcg       720
     ccagagcgca acgaggccat tgaccatatt gcccaaagca gcaagcagga ctggaaagac       780
     aaaagtggct accatcgccg ttccctggtg gagaacctga tgtaccgctt caaggtgctg       840
     acgggcgaca ggctgtgggc gcgcgatgtg gatgtgcaag acgctgaagt cgctgttcgg       900
     gtgggcatca tcaatcgcat gctggtgctt gcacgcccga aatccgtccg gattgcctaa       960
//

If you have problems or comments...

PBIL Back to PBIL home page