(data stored in ACNUC7421 zone)

EMBL: CP000529.PE278

CP000529.PE278       Location/Qualifiers
FT   CDS_pept        complement(281293..283803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0281"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC and GAF sensor(s)"
FT                   /note="KEGG: pol:Bpro_0428 diguanylate
FT                   cyclase/phosphodiesterase (GGDEF & EAL domains) with
FT                   PAS/PAC sensor(s); TIGRFAM: PAS sensor protein; diguanylate
FT                   cyclase; PFAM: GGDEF domain containing protein; EAL domain
FT                   protein; PAS fold-3 domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35605"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIX7"
FT                   /protein_id="ABM35605.1"
FT                   /translation="MPPGFIPGRPALTGGQVPTALQQAGHRLAMTERIAHIGSWALDLP
FT                   ALQLLTYSSEFAAILGLPADAPLTWDELADRFAPEYRKRIAALLQQCASHGTAFDEEMQ
FT                   IDTPLCRKWVRMACEAVQNKRGQIKSLQGVLQDISTQKHAQQETLHLAMRLTTTLASIT
FT                   EAFVTLDRQCCFTYLNQKSEQLLRHTTGELLGKEIWLVLVTDKNQRLRQELQRSIATNR
FT                   QLEFEDFYPGLGKWLEVRAYPFAEGLAVYFRDVSKRRKSQEQLMLLETCISRLNDIVLI
FT                   AEAQSGSPKVPYIVFVNQAFEEHTGYSGHEVLGQTPRKLFGPGAVQDELQGMTKMLLRK
FT                   RHARSELLIYRKNGSCFWLELEIVQVAVTADELTHWVAVGRDITQRKVNADAIHQLAFY
FT                   DPLTTLPNRLMLLNRLEQVMAQSAHPRRQGALMFIDVDKLKVLNDTLGHHKGDLLLQQV
FT                   AERLAGCVEDTDMVARLGGDEFVVLLENLGDDAGSAAAHARQLAEKVLEQLREPFDLGG
FT                   HQHYTTSSIGVTSLNAAHGSVSEVLKQADLAMYQAKTTGRNALCFFDPEMQAAVNANAA
FT                   VSSELHIALRKQEFVLHYQPQVDSQGRVNGVEALLRWHHPKRGLVMPTDFIPMAEETGL
FT                   ILPLGRWALATACEQLAAWAAWPQAADLSIAVNVSVRQFRHPDFVDQVMAEIRRTGIKP
FT                   QHLKLELTETLLADGMDVTLARMGTLKALGVTLALDDFGMGYSSLSLLKRLPLDQLKID
FT                   KSFVAEVLTDPADAAISRTIITLAHSLNLKVVAEGVETQAQQDFLVAEGCDQFQGFLFS
FT                   APLPIEALEAYLMAQSPPLKLQTA"
     atgccgcccg gcttcatccc tggccgtcca gccctgaccg gaggccaggt gccgaccgcc        60
     ttgcagcaag ccggccatcg cctggccatg accgagcgta ttgcgcatat cggcagctgg       120
     gcgctggacc tgccagcgct gcaactgctc acgtattcca gcgaattcgc cgccatcctg       180
     ggcctgccgg ccgatgcccc gctcacatgg gatgaactgg ccgacaggtt cgcgcccgag       240
     taccgcaaac gcatcgcagc gctgctgcag cagtgcgcca gccatggcac tgcttttgac       300
     gaagaaatgc agatcgacac cccgctctgc cgcaaatggg ttcgcatggc ctgtgaagcc       360
     gtgcaaaaca agcgcggcca gatcaaaagc ctgcagggcg tgctgcagga catctcgacc       420
     cagaaacatg cccagcagga gacgcttcac ctggccatgc ggctgaccac cacgctggcc       480
     agcatcaccg aagcctttgt caccctggac cgccagtgct gctttaccta cctcaaccag       540
     aaaagtgaac agctgctgcg gcacaccacc ggcgagctgc tgggcaagga aatctggctg       600
     gtcctggtca ccgacaagaa ccagcgcctg cgccaggaac tgcagcgctc cattgccacc       660
     aaccggcagc ttgaattcga ggatttttac cccggcctgg gcaaatggct cgaagtgcgc       720
     gcctatccct tcgccgaagg cctggcggtg tactttcgcg atgtgagcaa gcggcgcaag       780
     tcgcaggagc agctgatgct gctggaaacc tgcatctcac ggctcaacga catcgtgctc       840
     atcgccgagg cccagtctgg atcgccaaaa gtgccctata tcgtgttcgt caaccaggcc       900
     tttgaggagc acaccggcta cagcggccat gaagtgctgg gccagacgcc gcgcaagctt       960
     tttggccccg gagccgtgca ggacgaattg cagggcatga ccaaaatgct gctgcgcaag      1020
     cggcatgcgc gcagcgagct gctgatctac cgcaagaacg gcagctgctt ctggctcgaa      1080
     ctggagatcg tccaggtggc ggtgacggcg gacgaactca cccactgggt cgccgtgggg      1140
     cgcgacatca cccagcgcaa ggtcaacgcc gacgccattc accagctggc cttttatgac      1200
     ccgctgacaa ccctgcccaa ccggctgatg ctgctgaacc ggctggagca ggtgatggcc      1260
     caaagcgccc acccgcggcg ccagggtgcc ctgatgttca tcgacgtgga caagctcaag      1320
     gtcctgaacg acaccctggg ccaccacaag ggcgacctgc tgctgcagca ggtcgccgaa      1380
     cggctggcag gctgtgtcga ggacaccgac atggtggcgc gtctgggcgg cgatgaattt      1440
     gtcgtgctgc tggaaaacct gggcgacgat gcaggcagcg ccgccgcgca tgcccggcaa      1500
     ctggctgaaa aggtgctgga gcaattgcgc gaaccgtttg acctgggcgg acaccagcac      1560
     tacaccacct ccagcatcgg cgtgacctcg ctcaatgccg cccatggcag cgtcagcgaa      1620
     gtgctcaagc aggccgactt ggcgatgtac caggccaaga ccacgggccg caacgcgctg      1680
     tgcttttttg accccgagat gcaggccgcc gtcaatgcga acgccgccgt cagttccgag      1740
     ctgcatatcg cgctgagaaa gcaggagttt gtccttcatt accagcccca ggtggacagc      1800
     caggggcgcg tgaacggcgt cgaggccctg ctgcgctggc accatcccaa gcgcgggctg      1860
     gtcatgccga ccgacttcat tccgatggcc gaggaaaccg ggctgatctt gccgctgggc      1920
     cgatgggcgc tggccaccgc ctgcgaacag ctggcggcct gggcagcgtg gccgcaggcc      1980
     gccgatttga gcattgcggt gaatgtcagc gtgcgccagt tccggcatcc agatttcgtg      2040
     gaccaggtga tggccgagat ccggcgcacc ggcatcaagc cgcagcacct caagctcgaa      2100
     ctcaccgaaa ccctgctggc cgacggcatg gacgtcacgc tggcccggat gggcacgctc      2160
     aaggcgctgg gcgtgacgct ggcgcttgac gatttcggca tgggctactc gtcgctgtcc      2220
     ttgctcaagc gcctgccgct ggaccagctc aagatcgaca agagctttgt cgccgaagtg      2280
     ctgaccgacc cggccgatgc cgccatttcc cgcaccatca tcaccctggc ccacagcctg      2340
     aacctgaaag tggtggccga gggcgtggaa acccaggccc agcaggactt cctggttgct      2400
     gagggctgcg accagttcca gggctttttg ttttcagcgc cgctgccgat tgaagcgctg      2460
     gaggcctacc tgatggcgca gagcccgccg ctgaagcttc aaacggccta g               2511
//

If you have problems or comments...

PBIL Back to PBIL home page