(data stored in ACNUC7421 zone)

EMBL: CP000529.PE28

CP000529.PE28        Location/Qualifiers
FT   CDS_pept        complement(27624..29060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0029"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   KEGG: bur:Bcep18194_B0913 periplasmic sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35355"
FT                   /db_xref="GOA:A1VI77"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI77"
FT                   /protein_id="ABM35355.1"
FT                   /translation="MTKRNRIFIGILLIYAAGIALMLYRVVADIDPRYRESAEESLVET
FT                   SHLLAGLVEQDVRAGAIDTARLEPLFKALYAREFHARIYSVSKTRVEMRAYVADRQGRV
FT                   LFDSLGKSVGADFSQWHDVGLTLEGRYGARSTRDVPDDPRTSVMYVGAPIRWNNEIIGV
FT                   ASVGKPVTSFGQFVSAAREKTLYVGLVSVLAVLLLAVIVSVWLVRPFGLISDYVRYVRA
FT                   QRSFNFPRLGRRALGAIGAAYDEMRDALAGRNYVADYVQTLTHEVKSPLSAIRGAAELL
FT                   QEPSMPQAERQRFLANITREAGRIQEMVDRMMELTALETRRSLDKVQPVALKPLLEELA
FT                   SAAQDAARLRGIRIAVDAPEDAAVEGDGFLLRRAVSNLLDNAVDFSPEGSQVVLSLHLG
FT                   ARTVRVQVRDRGPGIPDYAQDKVFEKFYSLARPHSRKKSTGLGLAFVKEIASLHHGRIE
FT                   LVNADGGGALATLSLPRLAG"
     gtgaccaagc gcaaccgtat ttttataggc atcctgctga tctacgcggc cggcatcgcc        60
     ctgatgctct accgcgtcgt ggccgacatc gacccgcgct accgcgagtc agccgaggag       120
     tcgctggtcg aaacctcgca cctgctggcc ggcctggtcg agcaggacgt gcgcgccggc       180
     gccatcgaca cggcccggct ggagccgctg ttcaaggcgc tgtatgcgcg cgagtttcac       240
     gcgcggatct attcggtcag caaaacccgc gtcgagatgc gcgcctacgt cgccgaccgg       300
     cagggccggg tgctgttcga ctcgctgggc aagtcggtgg gcgccgattt ttcgcagtgg       360
     cacgatgtcg gcctgacgct cgaaggccgc tacggcgcgc gttccacgcg cgacgtgccg       420
     gacgacccgc gcacctcggt gatgtacgtg ggcgcgccga ttcgctggaa caacgagatc       480
     atcggcgtcg ccagcgtcgg caagccggtc accagctttg gccagttcgt ctcggccgcg       540
     cgcgaaaaaa ccctgtacgt cgggctggtg tcggtgctgg cggtgctgct gctggcggtg       600
     atcgtctcgg tctggctggt gcggccgttc ggcctgatct cggactacgt gcgctatgtg       660
     cgcgcccagc gctcgttcaa ttttccccgg ctgggccggc gcgcactcgg cgcgataggc       720
     gcggcctacg acgagatgcg cgacgcgctg gccgggcgca actacgtcgc cgactacgtg       780
     cagacgctga cgcacgaggt caaaagcccg ctgtcggcga ttcgcggcgc ggccgagctg       840
     ctgcaagagc ccagcatgcc gcaggccgaa cgccagcgct tcctggccaa catcacgcgc       900
     gaggccgggc gcatccagga aatggtggac cgcatgatgg aactgaccgc gctggagacg       960
     cgccgctcgc tcgacaaggt gcagcccgtg gccttgaagc cgctgctgga ggaactcgcc      1020
     agcgccgcgc aggatgccgc ccggctgcgc ggcattcgca tcgccgtcga tgcgcccgaa      1080
     gacgctgcgg tcgaaggcga tggctttttg ctgcgccgcg ccgtcagtaa cctgctggac      1140
     aacgcggtcg atttctcgcc cgagggcagc caggtcgtgc tgtcgctgca cctgggggcg      1200
     cgcaccgtgc gcgtgcaggt gcgagaccgg ggaccgggca tccccgacta tgcgcaggac      1260
     aaggtgttcg agaagttcta ttcgctggcg cgcccgcatt cgcgcaagaa aagcaccggg      1320
     ctggggctgg cgttcgtgaa ggaaatcgcg tcgctgcacc atgggcgcat cgaactggtc      1380
     aatgcggacg gcggcggggc gctggctacg ctgtcgctgc cgcgcctggc ggggtag         1437
//

If you have problems or comments...

PBIL Back to PBIL home page