(data stored in ACNUC7421 zone)

EMBL: CP000529.PE287

CP000529.PE287       Location/Qualifiers
FT   CDS_pept        complement(291738..292463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0291"
FT                   /product="LrgB family protein"
FT                   /note="PFAM: LrgB family protein; KEGG: pol:Bpro_0431
FT                   LrgB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35614"
FT                   /db_xref="GOA:A1VIY6"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIY6"
FT                   /protein_id="ABM35614.1"
FT                   /translation="MSDFVQLWVYLSATPLFGLTATLLVYVLAHAAYFRAGQAPWANPV
FT                   LWSVIVLACGLLATGVSYPSYFAGAQFIHFLLGPAVVALGWPLWLRRAELRQRWGRLLV
FT                   AALAGGSVAAGSSLLLGRLFGLPQELVLSLVPKSVTAPVAMGIAEQIGGIPALAAVFAV
FT                   ITGLVGALFGKYLFAALRIPTDAEGWAARGFALGTASHGLGAARAMHVNADAGAYAGLA
FT                   LGLQVVLASLLIPLVFKLF"
     atgtctgatt ttgtccagtt gtgggtctat ctgtcggcaa cgccgctctt cggcctgacc        60
     gcgaccttgc tggtgtacgt gctggcccat gccgcctact ttcgcgccgg acaggcgccc       120
     tgggcgaacc cggtgctgtg gtcggtcatc gtgctggcct gcggtctgct ggccaccggg       180
     gtgtcctatc cgagctactt tgccggcgcg cagttcattc atttcctgct cggtccggcg       240
     gtggtggcgc tgggctggcc gctgtggctg cgccgcgccg agttgcgcca gcgctggggc       300
     cgcctgctgg tggcggcgct ggcgggtggc agcgtggcgg cgggctcgtc gctgctgctg       360
     ggccgattgt tcggcctgcc gcaggagctg gttctttcgc tggtgcccaa gtcggtcacg       420
     gcgccggtgg ccatgggcat tgccgagcag atcggtggca ttccggccct ggcggcggtg       480
     tttgcggtga ttaccgggct ggtcggggcg ctgttcggca agtacctgtt cgcggccttg       540
     cgcatcccga cggacgccga aggctgggcg gcgcggggct ttgcgctggg aaccgcctcg       600
     cacggccttg gcgcggcccg cgcgatgcat gtgaatgcgg acgccggggc ttacgcgggc       660
     ctggcgctgg gcctgcaggt ggtgctggct tcgctgctga ttccgctggt tttcaagctg       720
     ttttga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page