(data stored in ACNUC7421 zone)

EMBL: CP000529.PE289

CP000529.PE289       Location/Qualifiers
FT   CDS_pept        complement(292879..294381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0293"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   pol:Bpro_0433 FAD linked oxidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35616"
FT                   /db_xref="GOA:A1VIY8"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIY8"
FT                   /protein_id="ABM35616.1"
FT                   /translation="MNAPASPQQLSSLERAERQSQVVRALEAVLPGHALLWNREDTTPY
FT                   ECDGLTAYRERPLVVALPETYAEVQAVLKACHALDVPVVARGAGTGLSGGAMPHTLGVT
FT                   LSLAKFNKILKVDAASRTAVVQGGVRNLAISEAASPFGLYYAPDPSSQIACTIGGNVAE
FT                   NSGGVHCLKYGLTVHNVLKVKGFTIEGDEVEFGSDALDSAGYDLLAIVIGSEGMLAVTT
FT                   EVTVRLIPKPLLARCIMASFDDLRKAGDAVAAVIAAGIIPAGLEMMDKPMTAAVEDFVH
FT                   AGYDLSAAAILLCESDGTPEEVEEEIGRMSAVLERHGATAIAVSQNEAERLRFWSGRKN
FT                   AFPASGRISPDYMCMDSTIPRKRLADILLAIGEMEIKYGLRCANVFHAGDGNLHPLIMF
FT                   DANDADQLHRCELFGADILETSVAMGGTVTGEHGVGVEKLNSMCVQFSAAENEQMFGVK
FT                   RAFDPKGLLNPGKVIPTLHRCAEYGKMLVRGGKISHPDLPRF"
     atgaacgcac ccgcctcgcc ccagcaactc tcttccctcg aacgcgccga gcgccagtcg        60
     caggtcgtgc gcgccctgga ggcggtgctg cccggccacg cgctgctctg gaaccgcgaa       120
     gacaccacgc cctacgaatg cgacgggctc acggcctacc gcgagcggcc gctggtggtg       180
     gcgctgcctg aaacctatgc cgaggtgcag gcggtgctca aggcctgcca tgcgcttgat       240
     gtgccggtgg tggcgcgcgg cgcgggcacc gggctgtcgg gcggcgccat gccgcacacg       300
     ctgggcgtga cgctgtcgct ggccaagttc aacaaaattt tgaaggtcga tgccgccagc       360
     cgcacggccg tggtgcaggg cggcgtgcgc aacctggcga tttccgaggc ggcctcgcct       420
     ttcggcctct attacgcgcc cgacccgtcg agccagatcg cctgcaccat cggcggcaac       480
     gtggccgaga actcgggcgg cgtgcattgc ctgaagtacg ggctgacggt gcacaacgtg       540
     ctcaaggtca agggtttcac catcgagggc gacgaggtcg agttcggcag cgacgccctc       600
     gatagcgccg gctacgacct gctggccatc gtcatcggca gcgaaggcat gctggccgtg       660
     acgaccgaag tcaccgtcag gctgatcccc aagccgctgc tggcgcgctg catcatggcc       720
     agcttcgacg acctgcgcaa ggccggcgat gcggtggcgg cggtgattgc ggccggcatc       780
     atcccggccg ggctggagat gatggacaag ccgatgacgg cggcggttga agacttcgtg       840
     catgcaggtt atgacctgag cgcggcggcg attttgctgt gcgagagcga cggcacgccc       900
     gaggaagtcg aggaagaaat cggccgcatg agcgcggtgc tggaacgcca tggcgcgacg       960
     gccatcgccg tgagccagaa cgaggccgag cggctgcgtt tctggagcgg gcgcaagaac      1020
     gcctttccgg cctcgggccg catcagcccc gactacatgt gcatggactc gacgattccg      1080
     cgcaagcgcc tggccgacat cttgctggcg attggcgaga tggaaatcaa gtacggcctg      1140
     cgctgcgcca atgtgttcca tgcgggcgac ggcaacctgc acccgctgat catgttcgac      1200
     gccaacgacg ccgaccagct gcaccgctgc gagctgttcg gcgccgacat tttagagacc      1260
     agcgtggcca tgggcggcac cgtgaccggc gagcacggcg tgggcgtgga aaagctcaac      1320
     tcgatgtgcg tgcagttctc ggcggcggaa aacgagcaga tgttcggcgt caagcgcgcg      1380
     tttgacccca agggcctgct caaccccggc aaggtgattc cgacgctgca ccgctgcgcc      1440
     gagtacggga aaatgctggt gcgcggcggc aagatctcgc acccggatct gccgcgcttc      1500
     tga                                                                    1503
//

If you have problems or comments...

PBIL Back to PBIL home page