(data stored in ACNUC7421 zone)

EMBL: CP000529.PE290

CP000529.PE290       Location/Qualifiers
FT   CDS_pept        294562..295128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0294"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   gvi:gll1561 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35617"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIY9"
FT                   /protein_id="ABM35617.1"
FT                   /translation="MGQAAQKIIFTAADYLAWEPAQAERHEYIDGEVFAMAGAEDRHVT
FT                   VSMNLAFALRQHLSSSPCRTYMSDMRLHVAAANSYFYPDVLVTCSALDLASPMVKTEPK
FT                   LIAEVLSPSTGAYDRGVKFSHYRSIASLEEYVLIDLDTRSTDCFRKGEDGLWVLHPFAR
FT                   GEAVSLASVALELSAAQLFAEVPEV"
     atgggccagg ccgcgcaaaa aatcatcttt accgccgccg actatcttgc gtgggagccg        60
     gcgcaagcag agcgccatga atacatcgac ggcgaagtgt ttgccatggc cggcgccgaa       120
     gaccggcatg tgacggtgtc catgaacctg gctttcgccc tgcgccagca cctcagcagc       180
     agcccgtgcc gcacctatat gagcgacatg cgcctgcacg tcgccgctgc caacagctac       240
     ttttaccctg acgtgctggt gacctgcagc gcgcttgacc tggccagccc gatggtcaag       300
     accgaaccca agctgattgc cgaagtcttg tcgcccagca ccggcgccta tgaccggggc       360
     gtgaaattca gccactaccg cagcattgca agcctggagg aatacgtgct gatcgacctc       420
     gacacgcgca gcaccgactg tttccgcaaa ggcgaggacg ggctgtgggt gctgcacccg       480
     tttgcccgtg gcgaggcggt gtcgctggcc agcgtggcgc tggagttgag cgcggcgcag       540
     ttgttcgcgg aagtgccgga ggtttga                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page