(data stored in ACNUC7421 zone)

EMBL: CP000529.PE295

CP000529.PE295       Location/Qualifiers
FT   CDS_pept        complement(298517..299653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0299"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   rso:RS03096 putative Leu/Ile/Val-binding lipoprotein
FT                   transmembrane; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35622"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIZ4"
FT                   /protein_id="ABM35622.1"
FT                   /translation="MKKLLAGLIASATLFAGASVQAVDGVTARQLLIGQSITLEGGKND
FT                   YGTAVLAGMQTYLSAVNARGGVNGRQVVLKTLDDDNKSAKAETNARQLVEKDKVFALFG
FT                   SIEGGPSVAVMKAANELKVPFFGPMAGSPTLRRPYQPLVFPVRAEHREEFFALISHARS
FT                   LGMRKVAFLRSDSETGEQHLANVRLICQRLGMTLVADLPFKSDITDAQLGAMVTQLEQA
FT                   GAQMVFNHGGVGIYEKLIRKARDKAMQTAFYAVNSASAQLVKRLGELSHGMVFTQVVPS
FT                   PWERKSAITREYQTEFARFMPGQEFSYGSLEGYVTAKALVAALRLAGTSPSREGFVTAL
FT                   EGATLDLNGLRASYDSSNHQGLAFVDISMVTRESKFRH"
     atgaaaaaac tgcttgccgg cctgatcgcg tccgccacac tgtttgccgg ggcttccgtc        60
     caggctgtcg atggcgtcac ggcccgacaa ctattgatcg gccagagcat caccctggag       120
     ggtggaaaaa acgactacgg cacggccgtg ctggcgggca tgcaaaccta cctgagcgcg       180
     gtcaacgcac gcggcggtgt caatggccgc caggtggtgc tgaaaacgct ggacgatgac       240
     aacaaaagcg caaaggccga aaccaacgca cgccagctgg tcgagaaaga caaggttttc       300
     gcgctgttcg gctccatcga gggtggcccg tcggtggccg tgatgaaggc ggcgaatgaa       360
     ctcaaggtgc cttttttcgg ccccatggcg ggctcgccga ccctgcgccg gccctatcag       420
     ccgctggtgt tcccggttcg cgcggagcac cgcgaggagt tttttgcgct gatttcacac       480
     gcccggtcgc tgggcatgcg caaggtcgcc tttcttcggt ccgactccga aaccggcgag       540
     cagcaccttg ccaatgtcag gctgatttgc cagcggctgg gcatgaccct ggtggccgac       600
     ctgccgttca agtccgacat caccgacgcc cagcttggag ccatggtcac gcaactggag       660
     caggccggtg cgcaaatggt gtttaaccac ggcggcgtgg gcatctacga gaaactcatt       720
     cgcaaggcca gggacaaggc gatgcagacc gccttctacg cggtgaattc cgcttcggcg       780
     caactggtca agcgtctggg cgagctttcg cacggcatgg ttttcacgca ggtggtgccc       840
     agcccctggg agcgcaaatc cgcgatcacg cgcgaatacc agaccgagtt tgcgcgattc       900
     atgccgggcc aggagttttc ctacggcagc cttgagggat acgtgacggc caaggcactc       960
     gttgccgcgc tgcggctggc cggcaccagc ccctcgcgcg aaggctttgt gacggcgctc      1020
     gaaggcgcta cgctcgacct caacggcctg cgcgccagct atgacagcag caatcatcag      1080
     gggctggcgt ttgtcgatat ttccatggtc acgcgcgagt cgaaattccg ccactga         1137
//

If you have problems or comments...

PBIL Back to PBIL home page