(data stored in ACNUC7421 zone)

EMBL: CP000529.PE299

CP000529.PE299       Location/Qualifiers
FT   CDS_pept        complement(302530..304749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0303"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_II0346 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35626"
FT                   /db_xref="GOA:A1VIZ8"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIZ8"
FT                   /protein_id="ABM35626.1"
FT                   /translation="MFATIRRSGSGIFRWLYGAILIFAMGAAQAQNLSKMALLLPDGLA
FT                   VNDVQVTAWTDAAQEQGYQMSILRNADFLLLGAGARTQYSGIIVPDQIQVSMSDALVAT
FT                   IQSYVTQGGNIMLVYDAGALTANGFYAIPKSRFSDLVGVDYVLYDSLLDRTVGLGPVIG
FT                   LESTLRALHIPPGKSIPYTQTATTVTALADTPRAIQVADNGKKAPAGKATADFLPASPA
FT                   NPGGLKGYDHAQYFKSEPGVTEGSKERAKKLKQKIIDNKGKKNEKAIQREAVPGVTPNK
FT                   LSKDALRNLSTSSRIGNPSLGAKRYLTQASPPATDPVHAISGYVYGALTYPSFVTQGTA
FT                   LGATLMSSPDHGLVASSRTVGTGSVLFVNLPLTYLKLYEDSMPMHGFLHLFARGPAKQP
FT                   RLTNVPDGIGGLVFNWHLDSKEAQAPIQTLKNMGVWNYKPFSIHITAGPDTIVPGDKLG
FT                   FDLPNNPTMKQHLKNFVATGHEVGSHGGWIHDYYGDNANETNQAQFQPYLVLNRDAVQA
FT                   AIGKPSTEYSAPQGNNPLWAVTWLQQNGVNSFYSLSHTGSAVTRSYRGGGLPNPTMWAV
FT                   PVTPFGVAATFEEFEELLFTEADINKWYKDLIDFSYANETNRMIYAHPPGAVEFPNVMT
FT                   TLLQYANTQQTAGKFRWYTMTRLRNFMVQRSNTTWQSAIAANGKMRVTASNTTTNLVNL
FT                   TWAYPKTKYAKPVAVSGTMSIVDQGTDWLVRITAGKNATFDAAPL"
     atgtttgcca ccatcaggag atccggttcg ggtatttttc gctggctgta cggcgccata        60
     ctgatctttg ccatgggcgc ggcccaggcg cagaacttgt cgaaaatggc gctgctgctg       120
     cccgacgggc tggccgtcaa tgacgtgcag gtcaccgcct ggaccgatgc ggcgcaggag       180
     cagggctacc agatgtcgat tcttcgcaat gccgacttcc tgctgctcgg ggccggcgcc       240
     cggacgcaat acagcggcat catcgttccc gaccagatcc aggtgtcgat gagcgatgcg       300
     ctggtcgcca ccatccagag ctatgtcacg cagggcggca acatcatgct ggtgtatgac       360
     gccggcgcgc tcacggccaa cggcttttac gccatcccga agtcgcgctt cagcgacctg       420
     gtgggcgtgg actatgtgct gtatgactcg ctgctcgacc gcaccgtggg cctgggtccg       480
     gtcattggcc tggagtccac cctgcgcgcg ctgcacatcc ctccgggaaa atcgattccc       540
     tatacccaga cggcaaccac ggtgacggcg cttgcagaca cgccacgcgc catacaggtg       600
     gccgacaacg gcaaaaaggc ccctgctggc aaggccaccg cggactttct gcccgccagc       660
     cccgccaacc ctggcggcct gaagggctat gaccatgcgc agtacttcaa gtcagagccc       720
     ggcgtcaccg agggctccaa ggaaagagcc aagaaactga agcaaaaaat cattgataac       780
     aaaggtaaaa agaacgaaaa agccatccag cgcgaagctg tgccaggtgt gacgcccaac       840
     aagctcagca aggacgcgct gagaaacctc agcaccagca gtcggatcgg caacccgtcc       900
     ctgggcgcca aacgctattt aacgcaggcg agccccccgg cgaccgatcc ggtccacgcc       960
     atttccggct atgtctatgg cgccttgacc tatcccagct tcgtgacgca gggaacggcg      1020
     ctgggtgcca cgctgatgtc ctcgcccgat cacggcctgg tcgccagcag ccgcaccgtg      1080
     ggcaccggca gcgtgctgtt cgtgaatctg ccgctgacct atctcaagct gtacgaggac      1140
     tccatgccca tgcacggctt cctgcacctg ttcgcacgcg gaccggccaa gcagccgcgc      1200
     ctgaccaacg tgcctgacgg cattggcgga ctggtgttca actggcacct ggactccaag      1260
     gaagcccagg cgccgataca gaccctcaag aacatggggg tgtggaacta caagccgttt      1320
     tccatccaca tcacggcggg ccccgacacc attgttcccg gcgacaagct gggcttcgat      1380
     ttgcccaaca accccacgat gaagcagcat ttgaagaact tcgtcgcgac gggtcatgag      1440
     gtgggaagcc acggcggctg gattcacgac tactacggcg acaacgccaa tgaaaccaac      1500
     caggcccagt tccagcccta cctggtgctc aaccgcgacg ccgttcaagc cgccattggc      1560
     aaaccctcga cggaatactc cgccccgcaa ggcaacaacc cgctgtgggc ggtgacctgg      1620
     cttcagcaga acggcgtcaa ttccttctac tcgctcagcc ataccggatc agcggtcacc      1680
     cgcagctatc gcggcggcgg cctgcccaac ccgacgatgt gggccgtgcc ggtgacgccg      1740
     ttcggagtgg cggcgacctt cgaggagttc gaggaactgc tgttcacgga ggccgatatc      1800
     aacaagtggt acaaggacct gatcgacttt tcatacgcca atgaaaccaa ccgcatgatt      1860
     tatgcccacc cgcccggtgc cgtcgagttc cccaacgtga tgaccaccct gctgcagtac      1920
     gccaacacgc agcagacggc cggcaagttc cgctggtaca ccatgacccg gctgcgcaac      1980
     ttcatggtcc agcgttccaa caccacatgg caaagcgcca tcgccgccaa cggcaagatg      2040
     cgcgtgacgg ccagcaacac caccaccaac ctggtcaacc tgacttgggc ttatccaaaa      2100
     accaagtacg cgaagccggt tgccgtgtcg ggaaccatga gcatcgttga ccagggcacc      2160
     gactggctgg tgcgcatcac cgcaggcaag aacgccacct tcgatgcggc gcctttgtaa      2220
//

If you have problems or comments...

PBIL Back to PBIL home page