(data stored in ACNUC7421 zone)

EMBL: CP000529.PE300

CP000529.PE300       Location/Qualifiers
FT   CDS_pept        305021..305269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35627"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIZ9"
FT                   /protein_id="ABM35627.1"
FT                   /translation="MIYINATHAAKSLQIGKPAWGKRAGFGRPGPRDGPIEAKVVKARQ
FT                   KENSVSSAVAGWSRRTGIQDLALNNFPSVIPAKGRYC"
     ttgatttata tcaacgcgac ccatgccgca aaatcacttc aaataggcaa gccagcctgg        60
     ggaaaaagag ccggttttgg gagaccaggc cctagggacg ggccaattga agcaaaagtc       120
     gtcaaggcga gacaaaagga aaattctgta tcaagcgctg tcgccggctg gtcacgacgc       180
     acgggcatcc aggatttggc actaaacaac ttcccgtccg tcattcccgc gaagggacgt       240
     tattgctga                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page