(data stored in ACNUC7421 zone)

EMBL: CP000529.PE309

CP000529.PE309       Location/Qualifiers
FT   CDS_pept        314236..314685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0313"
FT                   /product="YiaAB two helix domain protein"
FT                   /note="PFAM: YiaAB two helix domain protein; KEGG:
FT                   pol:Bpro_0458 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35636"
FT                   /db_xref="GOA:A1VJ08"
FT                   /db_xref="InterPro:IPR008024"
FT                   /db_xref="InterPro:IPR038972"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ08"
FT                   /protein_id="ABM35636.1"
FT                   /translation="MTTQYVMQRDTGGWRIQVWTSFTLAVLASGTGVMQLPSQELDRAF
FT                   LAIGFFFCLFAAFAAAKTVRDNRDGRVDTNGWIITVWVSFAAAVCLTAWGLWRMNIGDW
FT                   QKGYMVVSWMFLISSTFTLAKTIRDRYEADLMTRSNEPAPETRPA"
     atgacaactc aatatgtgat gcagcgcgat accggcggct ggcgcattca ggtctggact        60
     tcgttcactc tggcggtgct ggccagcggc acgggcgtga tgcagctgcc cagccaggag       120
     ctggaccggg cctttctggc catcgggttt ttcttttgcc tgttcgctgc ctttgcggcg       180
     gccaagaccg tgcgcgacaa ccgcgacggg cgggtggaca ccaacggctg gatcatcacg       240
     gtgtgggttt cctttgcggc ggcggtgtgc ctcacggcgt ggggcttgtg gcgcatgaac       300
     atcggggact ggcaaaaggg ctacatggtc gtgagctgga tgtttctgat cagcagcacg       360
     ttcacgctgg ccaagacgat ccgcgaccgt tacgaggccg acctgatgac gcgcagcaac       420
     gagcccgcgc ctgaaacgcg gcccgcctga                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page