(data stored in ACNUC7421 zone)

EMBL: CP000529.PE31

CP000529.PE31        Location/Qualifiers
FT   CDS_pept        31502..31687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0032"
FT                   /product="protein of unknown function DUF1328"
FT                   /note="PFAM: protein of unknown function DUF1328; KEGG:
FT                   pol:Bpro_0066 protein of unknown function DUF1328"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35358"
FT                   /db_xref="GOA:A1VI80"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VI80"
FT                   /protein_id="ABM35358.1"
FT                   /translation="MIKYAIIFAVISLIAGALGFSGVAAGAAGIAKVLFGLFLILAVIF
FT                   IVLAALGVGAAKKMMK"
     atgattaagt atgcgattat ttttgccgtg atttcgctga ttgccggtgc cctgggcttt        60
     agcggcgtgg cggcgggcgc ggcgggcatt gccaaggtgc tgttcgggct gttcctgatt       120
     ctggccgtga tctttatcgt gctggccgcg ctgggcgtgg gcgccgccaa gaaaatgatg       180
     aaataa                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page