(data stored in ACNUC7421 zone)

EMBL: CP000529.PE310

CP000529.PE310       Location/Qualifiers
FT   CDS_pept        complement(314705..315595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35637"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ09"
FT                   /protein_id="ABM35637.1"
FT                   /translation="MRSSPSIPDGFNFIIHSFAPNQTNAMPEHKNDSRRAYANAPVNQR
FT                   TAPREVAKPPPVHASLKARAQKARQRQLLGPSISDLLARRTSGAPRQHEKLHPGVIAAT
FT                   VCAVAAASALVLIRTGAGLALAAALAALGGASWLWQHRSQRAASETMPMPAGPPPFEPE
FT                   ALRRIDEAFEATAAIVTGPLLAALVSLKAAAVRMALALNGVQADDGFTLDDRMYVIESI
FT                   RRYIPDTLSAYLQVPTAQRPVPGAGEGKSANDLLQGQLALLQSELEQREQRLHGSAVEA
FT                   LRRQQRFLQSKATRG"
     atgcgaagca gcccttcaat tcccgacggt ttcaatttca taattcactc cttcgcaccg        60
     aaccaaacca acgccatgcc tgagcacaaa aatgattccc gacgcgctta tgccaatgcg       120
     cccgtcaacc agcgtaccgc gccacgggaa gtcgccaagc cgcctcccgt gcatgcttcg       180
     ctcaaggcac gcgcgcaaaa ggccaggcag cgccagttgc tcggtccgtc catcagcgat       240
     ctgctggcgc gccgcacctc gggcgctccg cgccagcacg aaaaacttca tccgggcgtg       300
     attgccgcaa cggtgtgcgc cgtggcggcg gcaagcgccc tggtcctgat ccgtacaggc       360
     gccgggctgg cgctggctgc agcgctggcg gcgctcggcg gcgccagctg gctgtggcag       420
     caccgaagcc agcgcgcggc cagcgaaacg atgccgatgc ccgccggccc gccgccgttc       480
     gagcccgaag cactgcgccg gattgacgag gcctttgaag ccaccgccgc catcgtgacc       540
     gggccgctgc tggccgcgct ggtatcgctc aaggccgctg cggtgcggat ggcactggcg       600
     ctcaatggcg tgcaagccga tgacggcttc acgctggacg accgcatgta cgtgatcgaa       660
     tccatccggc gctacattcc cgacacgctc agcgcctacc tgcaggtgcc caccgcgcag       720
     cgccccgtgc cgggcgcggg cgaaggcaag tccgccaacg acctcctgca gggccagctg       780
     gcgctgctgc agtccgagct ggaacagcgc gagcagcgcc tgcacggcag cgcggtcgag       840
     gccctgcggc gccagcagcg ctttttgcaa tccaaggcga cgcgcggctg a                891
//

If you have problems or comments...

PBIL Back to PBIL home page