(data stored in ACNUC7421 zone)

EMBL: CP000529.PE311

CP000529.PE311       Location/Qualifiers
FT   CDS_pept        315758..316816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0315"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0461 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35638"
FT                   /db_xref="GOA:A1VJ10"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ10"
FT                   /protein_id="ABM35638.1"
FT                   /translation="MSKSLRLTEKWMQRGLWLVALVFASFLIGLGGTLVGDLPKVEKQL
FT                   TLDDFMDRAASTALRSSIKTTEAAERDADAALEQAQLKRRVTQADSAAARETFNNWLST
FT                   RHATQLSGQDPELVARTRALDGLKDKERAAGMAVEAQQQAALDARQSSVRERRKLAEME
FT                   QAAQKLLNAEYRRIELRVFLYRLALTLPLLVAAGWLFAKKRKSTWWPFVWGFILFALFA
FT                   FFVELVPYLPSYGGYVRYIVGIVVTVLVGRQAILALNRYLEKQKLVEQLPDAQRREELS
FT                   YDTALTRLSKGVCPGCERPVDLKNPEIDFCPHCGIGLFDHCRACNTRKGAFAKFCHACG
FT                   ATGQRAHLPAQA"
     atgagcaaaa gcctgcgatt gaccgaaaaa tggatgcagc gcggcctgtg gctggtggcg        60
     ctggtgttcg ccagtttcct catcggcctg ggcggcacgc tggtcggcga cctgcccaag       120
     gtggaaaagc agctcacgct cgacgatttc atggaccgcg ccgccagcac cgcgctgcgc       180
     agtagcatca aaaccaccga agccgccgag cgcgatgccg atgccgcgct ggagcaggcc       240
     cagctcaagc gccgcgtgac gcaggccgac tccgcggcgg cgcgtgaaac cttcaacaac       300
     tggctctcga cccgccacgc cacgcagcta tccgggcaag accccgaact ggtggccaga       360
     acccgggcgc tcgatggcct gaaagacaag gagcgcgccg ccggcatggc ggtcgaggcc       420
     cagcagcagg ccgcgctcga tgcgcggcaa agcagcgttc gcgagcgccg caagctggcc       480
     gaaatggagc aggcggcgca aaaactgctg aatgccgaat accgccgcat cgagctgcgg       540
     gtgtttttgt accgcctggc gctgaccttg ccgctgctgg tggcggccgg ctggctgttc       600
     gcgaaaaagc gcaaaagcac ctggtggccg tttgtctggg gcttcatctt gtttgcgctg       660
     ttcgcctttt tcgtcgagct ggtgccttat ttgccgagct acggcggcta tgtgcgctac       720
     atcgtcggca tcgtggtgac ggtgctggtc ggcaggcagg ccatcctggc gctgaaccgc       780
     tacctcgaaa agcaaaagct cgtcgagcag ctgcctgacg ctcagcgccg cgaggaactg       840
     agctacgaca ccgctctgac gcggctgtcc aaaggcgtgt gccccggctg cgagcggccg       900
     gtggatttga aaaacccgga gatcgacttt tgcccgcatt gcggcatcgg cctgttcgac       960
     cattgccggg cctgcaacac gcgcaagggt gcgtttgcca agttctgcca cgcctgcggg      1020
     gcaaccggcc agcgggcgca cttgccggcc caggcctga                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page