(data stored in ACNUC7421 zone)

EMBL: CP000529.PE312

CP000529.PE312       Location/Qualifiers
FT   CDS_pept        316942..318291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_4510 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35639"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ11"
FT                   /protein_id="ABM35639.1"
FT                   /translation="MKAHLQAHLRNQVAALFFLLPVATALVALPATVMAQPAAPELRSL
FT                   EVTSDDGLRAGAELEFTVEGTPRSRVGLRINGVRRDIALRETERGVYTGSYTIKRQDRI
FT                   SPANPIRATLRTRNRNIAVNYSFPAGMANPAVAAPLAAPVPPVAVLKIERFSVAPIDKI
FT                   EPGAELKFSLNGPPGGSAEVEIPGVNRVSMREVRPGAYEGAYTLRRMDNLLPSRPIVAT
FT                   LRVGNQSVKSNLTQALTADAKPPVLRNLAPREGEAVVDRAAISVSATFDDAGGVGVDPK
FT                   SVRILLSGRNVTPDSEVTPQFFSYRADLPIGRHTVDVTARDMVGNAMHKTWGFDVVVPV
FT                   SAMPATVPLQITSHANNAIVDGGTTVVRGRTAPGAVVDIRVQAFIPVAALFGVNQEPMT
FT                   QRVQADGNGNFTFSFASQLPLPGTRYEVTMVSHKADLSTESKLVLFQKQG"
     atgaaggctc acctacaggc ccacctgcgc aaccaggtcg ccgcgctctt ttttctgttg        60
     ccggtcgcca cggcgctggt cgccttgccc gcaacggtca tggcgcagcc tgcggcgccc       120
     gagttgcgct ccctcgaagt cacctcggat gacggcttga gggccggcgc cgagctggag       180
     ttcaccgtcg aaggcacgcc ccggtcacgg gtcggtctgc gcatcaacgg tgtgcggcgg       240
     gacattgcgc tcagggaaac cgagcgcggc gtctataccg gcagctacac catcaagcgc       300
     caggaccgta tctcgccggc caatccgata cgcgccaccc tgcgcacgcg caaccgcaac       360
     atcgccgtca actacagctt tccggccggc atggcgaatc cggcggtggc cgcgccgctg       420
     gccgctccgg tgccgccggt cgcggtgctg aagatcgagc gcttcagcgt cgcgccgatt       480
     gacaagatcg agccgggcgc cgagctgaag ttctcgctca atggcccgcc gggcggcagc       540
     gccgaggtcg agattcccgg cgtcaaccgc gtttccatgc gcgaggttcg tccgggtgcc       600
     tatgaaggcg cctacaccct tcggcgaatg gacaatctgc tgccgtcgcg cccgatcgtg       660
     gcgaccctgc gggtgggcaa ccagtcggtt aaaagcaacc tgacccaggc cctgacggcc       720
     gacgccaagc cgccggtgct gcgcaacctg gcgccgcgcg agggcgaggc cgtcgtggac       780
     cgcgccgcca tttcggtgtc ggccaccttt gatgacgcgg gcggcgtggg ggttgacccc       840
     aagagcgttc gcatcctgct gtccggccgc aatgtcacgc ccgacagcga ggtcaccccg       900
     cagttcttct cctaccgcgc cgacctgccg atcggccgcc acacggtgga cgtgaccgcc       960
     agggacatgg tcggcaatgc catgcacaag acctggggat tcgacgtggt cgtgccggtc      1020
     agcgcgatgc ccgccacggt gccgctgcaa atcaccagcc atgccaacaa tgccatcgtc      1080
     gatggcggca cgacggtggt acgaggccgt accgcgccgg gcgcagtggt cgatatcagg      1140
     gttcaggcgt tcatccctgt ggccgccctg ttcggcgtga accaggagcc gatgacgcaa      1200
     agggtgcagg ccgatggaaa cggcaacttc accttcagct tcgcatcgca gctgcccctg      1260
     ccgggcacgc gctatgaagt gacgatggtc tcgcacaagg ccgacctgag caccgagtcc      1320
     aagctggtgc tgttccagaa acagggctga                                       1350
//

If you have problems or comments...

PBIL Back to PBIL home page