(data stored in ACNUC7421 zone)

EMBL: CP000529.PE313

CP000529.PE313       Location/Qualifiers
FT   CDS_pept        complement(318385..320175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0317"
FT                   /product="4-amino-4-deoxy-L-arabinose transferase and
FT                   related glycosyltransferases of PMT family-like protein"
FT                   /note="KEGG: pol:Bpro_0463 4-amino-4-deoxy-L-arabinose
FT                   transferase and related glycosyltransferases of PMT
FT                   family-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35640"
FT                   /db_xref="GOA:A1VJ12"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ12"
FT                   /protein_id="ABM35640.1"
FT                   /translation="MSSPEKSPAARLPHHLVWIGLAIAVALGYLFGLGGDHIPRNGDEL
FT                   VYANIARLTAASGHWLPLHSAWDFMRNTKPPLLFWQAMVAGGWGEHWTLLRLRLPSVAY
FT                   TWGIALMVGLLTWKTVRGDAGATSGNAATAAQRNHHAMTMGAIAVLVYLSFFTTYRYGR
FT                   PYLTSAPETFWLFGVFFAIAWSPARLLASSWKFPLIAGLAIGIGCLYKSFVMVAPVGFA
FT                   LALCYQAVGARLAPWKLARPGIVADGVKVLAICALGLAVFGLWFAIDPQPGEVWREFVV
FT                   GENAGKMNSSKGYFQTAFSGSSGILTILTGYFSNALFLLPLSVGCFVAAWRSWRQRQGT
FT                   AQTISDAEKIMWLWLLALALVFMLPTQRSTRYLIPAMPALAVVMALYWHRIGRIWFSLT
FT                   LAVCMIGLLAMGLIGYGAVRATQNPWVFSPLFWLFVAASALACLIGIFKKAWSRPVAAL
FT                   AGFSVLFALAWVTNPFNGELGRFRPETNALLKGQKVQVPSNFNGHFERYEFIIPGAKIV
FT                   DYFAAQPVDYADVEGLFKTSRYVLVQRRIGQPPCTRCRIIDERWDLRSRQDENDGFMAA
FT                   LKTPETYWYAKEYLVEPLAP"
     atgtccagcc ccgaaaaatc gccagccgcc cgccttccgc atcacctggt ctggataggc        60
     ctggccattg ccgtggcgct gggctacctg ttcggcctgg gcggcgacca cattccgcgc       120
     aatggcgacg agctggtcta tgccaacatc gcccggctga ccgccgccag cggccactgg       180
     ctgccgttgc acagcgcctg ggacttcatg cgcaacacca agccgccgct gctgttctgg       240
     caggccatgg tggccggcgg ctggggcgag cactggacgc tcctgcggct gcgcctgccc       300
     agcgtggcct acacctgggg cattgcgctg atggtgggcc tgctgacctg gaagacggtt       360
     cgcggcgatg caggcgcaac ctccggcaat gccgccacgg ctgcgcaacg aaaccaccac       420
     gcgatgacca tgggcgccat cgcggtcctc gtttacctgt cgtttttcac gacctaccgc       480
     tacggccgcc cttacctgac cagcgcaccg gaaaccttct ggctgttcgg cgtgttcttt       540
     gccatcgcct ggtcgccggc caggctgctc gcgtccagct ggaagttccc gctgatcgcc       600
     ggcctggcca tcggcatcgg ctgcctgtac aaatcgttcg tcatggtggc gccggtcggc       660
     ttcgcgctgg cgctgtgcta ccaggcggtg ggcgcccggc tggcgccctg gaagcttgcg       720
     cggcccggca tcgtggccga cggcgtcaag gttctggcca tctgcgccct tggactggcg       780
     gttttcggcc tgtggttcgc catcgacccg cagccgggcg aggtctggcg cgaattcgtc       840
     gtcggcgaga acgccggcaa gatgaactcc tccaagggtt atttccagac cgccttcagc       900
     ggcagcagcg gcatcctgac gattttgacg ggctacttct ccaatgccct gttcctgctg       960
     ccgctctcgg tcggttgctt cgtggcggcc tggcgcagct ggcggcagcg ccagggcacg      1020
     gcgcaaacca tcagcgacgc cgaaaaaatc atgtggctct ggctgctggc gctggcgctg      1080
     gtgttcatgc tgccgacgca gcgctcgacg cgctacctga ttccggccat gccagcactg      1140
     gccgtggtga tggcgctgta ctggcaccgg attggccgca tctggttcag cctgacgctg      1200
     gcggtctgca tgatcggcct gctggcgatg ggcctgatcg gctatggcgc cgtgcgggcc      1260
     acgcagaacc cctgggtgtt ctcgccgctg ttctggctgt tcgtggcggc ctcggcgctg      1320
     gcctgcctca tcggcatctt caagaaggcc tggagccggc cggttgccgc gctggccggg      1380
     ttcagcgtgc tgtttgcgct ggcctgggtc acgaacccgt tcaacggcga actcggccgt      1440
     ttccgccccg aaaccaatgc ccttctcaag ggccagaagg tgcaggtgcc gagcaatttc      1500
     aacggccatt tcgagcgcta cgaattcatc attccgggcg cgaagatcgt ggactatttt      1560
     gccgcccagc cggtcgatta cgccgatgtg gagggcctgt tcaagaccag ccgctacgtg      1620
     ctggtgcagc ggcgcatcgg gcagccgccg tgcacccgct gccgcatcat tgacgagcgc      1680
     tgggatctgc gctcgcgcca agacgaaaac gacggcttca tggccgccct gaagacgccc      1740
     gagacttact ggtacgccaa ggaatacctg gtcgagccgc tggcgccctg a               1791
//

If you have problems or comments...

PBIL Back to PBIL home page