(data stored in ACNUC7421 zone)

EMBL: CP000529.PE321

CP000529.PE321       Location/Qualifiers
FT   CDS_pept        327973..328497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0325"
FT                   /product="Ferritin, Dps family protein"
FT                   /note="PFAM: Ferritin, Dps family protein; KEGG:
FT                   ana:all4145 probable DNA-binding stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35648"
FT                   /db_xref="GOA:A1VJ20"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ20"
FT                   /protein_id="ABM35648.1"
FT                   /translation="MAKSPAKTILKATLQGAPAINIGISEKDRAAIAQGLSRLLADTYT
FT                   LYLTTHNFHWNVTGPMFNTLHTMFMVQYTELWNAVDPVAERIRSLGHPAPGSYAQFSLL
FT                   ATVPDVPVTPPKALEMVRILVQGHEAVARTARELFPMADEARDEPTADLLTQRMTVHEQ
FT                   TAWMLRSLLEE"
     atggccaaat ctcctgctaa aaccattctc aaagcgacgc ttcaaggcgc cccggcgatc        60
     aatatcggca tcagcgaaaa agaccgtgcc gcgattgccc agggcctgag tcgcctgctg       120
     gccgacacct acacgctcta cctgacgacg cacaatttcc actggaacgt gaccgggccg       180
     atgttcaaca cgctgcacac catgttcatg gtgcagtaca ccgagttgtg gaatgcggtg       240
     gacccggtgg ccgaacgcat ccgttcgctc ggccatccgg cgcccggctc gtatgcgcag       300
     ttcagcctgc tggccacggt gcccgatgtg ccggtgacac cgcccaaggc gctggaaatg       360
     gtccgcatcc tggtgcaggg ccacgaagcg gtcgcccgta ccgcccgcga gctgtttccc       420
     atggccgacg aggcccgtga cgagccgacg gccgacctgc tgacgcagcg catgacggtg       480
     catgagcaga ccgcctggat gctgcgttcg ctgcttgaag agtaa                       525
//

If you have problems or comments...

PBIL Back to PBIL home page