(data stored in ACNUC7421 zone)

EMBL: CP000529.PE324

CP000529.PE324       Location/Qualifiers
FT   CDS_pept        complement(330919..332412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0328"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /note="TIGRFAM: glycerol kinase; PFAM: carbohydrate kinase,
FT                   FGGY; KEGG: pol:Bpro_0476 glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35651"
FT                   /db_xref="GOA:A1VJ23"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ23"
FT                   /protein_id="ABM35651.1"
FT                   /translation="MAYLLALDQGTSSSRSIVFDEEGRVVALAQRELPQIYPRPGWVEH
FT                   DPMEIWRGQLATARQALASVGLAAWDIRAMGITNQRETTVLWNRRTGQPVHHAIVWQDR
FT                   RAESTCAQLREQGHEALIQAKTGLLIDAYFSGTKLKWLLDNVAGVRAQAERGELAFGTI
FT                   DSWLIWQLTGGTVHATDVSNASRTMLFNVRTNQWDAELLDLLGIPASLMPEVKPSSAHY
FT                   GEVRPELLGHAIPIGGVAGDQQSALFGQACFRAGMAKNTYGTGCFLLMHTGAQFQASKN
FT                   GLLTTSAAQTTAQTEFALEGSVFVGGAVVQWLRDGLHAIQGSAEVEALAQSVPDSGGVM
FT                   MVPAFTGLGAPYWKPEARGTITGLTRGTTMAHIARAALESIAYQSAALLLAMSRDAVAA
FT                   GAAPLAELRVDGGASSNDLLMQFQADLLGIPVIRPAVTETTALGAAWLAGLSSGVYGST
FT                   DELSSLWRAERTFLPTLSTGRAAELMAQWEHAVRQTVLA"
     atggcctatc ttctcgccct cgatcaggga acctccagtt cgcgaagcat tgtgtttgac        60
     gaagaaggcc gcgtggtggc gctggcccag cgggagttgc cgcagattta tcccaggccg       120
     ggctgggtcg agcacgaccc gatggaaatc tggcgcggcc agctggccac ggcgcggcag       180
     gcgctggcca gcgtgggcct ggccgcctgg gacatccggg cgatgggcat caccaaccag       240
     cgcgaaacca cggtgctctg gaaccgcagg accggccagc cggttcacca tgccatcgtc       300
     tggcaggacc ggcgcgccga gtccacctgc gcgcaattgc gcgagcaagg ccatgaagcg       360
     ctgattcaag ccaagacagg gctgctcatc gacgcctatt tttcaggcac caagctcaag       420
     tggctgctcg acaacgtagc cggtgtgcgc gcgcaggccg agcgcggcga actggccttt       480
     ggcaccatcg acagctggct gatctggcag ctgacgggcg gcaccgtgca tgccaccgac       540
     gtcagcaatg cctcgcgaac gatgctgttc aatgtgcgta ccaaccagtg ggatgccgaa       600
     ctgctggacc tgctgggcat tccggcgtcg ctgatgcccg aggtgaagcc gtccagcgcg       660
     cactacggcg aggtgcggcc cgagctgctg ggccatgcta tcccgattgg tggcgtcgcg       720
     ggcgaccagc aaagcgcgct gttcggccag gcctgcttca gggccggcat ggccaagaac       780
     acctacggca ccggctgctt cctgctgatg cacaccggcg cgcagttcca ggcgtcgaag       840
     aacggcctgc tgaccaccag cgccgcccaa accacggcgc agaccgaatt cgccctggaa       900
     ggcagcgtat tcgtcggcgg cgcggtggtg cagtggctgc gcgacggcct gcacgccatc       960
     cagggcagcg ccgaggtcga ggcgctggcg caaagcgttc ccgactcggg cggcgtgatg      1020
     atggtgccgg ccttcaccgg cctgggcgcg ccctactgga aacccgaggc gcgcggcacc      1080
     atcaccggcc tgacgcgcgg cacgaccatg gcccacattg cgcgcgcggc gctggaaagc      1140
     atcgcctacc agagcgccgc gctgctgctg gccatgagcc gcgatgctgt cgccgcaggc      1200
     gccgcgccgc tggccgagtt gcgcgtcgat ggcggcgcca gcagcaacga cctcctgatg      1260
     caattccagg ccgacctgct gggcattccg gtgatccgcc cggccgtgac cgaaaccacg      1320
     gcgctgggtg cggcctggct ggcgggcctg tccagcggcg tgtacggcag taccgacgag      1380
     ctttccagcc tgtggcgcgc tgaacgcacc ttcctgccca cgctcagcac cgggcgcgca      1440
     gccgaactga tggcgcaatg ggagcatgcg gtgcggcaga cggtgctggc gtag            1494
//

If you have problems or comments...

PBIL Back to PBIL home page