(data stored in ACNUC7421 zone)

EMBL: CP000529.PE332

CP000529.PE332       Location/Qualifiers
FT   CDS_pept        336956..337321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0336"
FT                   /product="LSU ribosomal protein L18P"
FT                   /note="PFAM: ribosomal protein L18P/L5E; KEGG:
FT                   pol:Bpro_0491 ribosomal protein L18P/L5E"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35659"
FT                   /db_xref="GOA:A1VJ31"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ31"
FT                   /protein_id="ABM35659.1"
FT                   /translation="MLTKKEQRLRRSRQTRIRIANQGVARLSVNRTNLHIYASVISGDG
FT                   TKVLASASTAEVEVRNEIGGSGKGGNVAAAQAIGKRIAEKAKAAGVEKVAFDRAGFAYH
FT                   GRVKALADAAREAGLQF"
     atgttgacca aaaaagagca gcgccttcgt cgttcacgcc agacccgcat ccgcattgcc        60
     aatcaaggcg ttgcccgtct gtccgtgaat cgcaccaatc tgcatattta cgccagtgtt       120
     atttctggcg acggcaccaa ggttctggcg tctgcttcca ctgctgaagt ggaagtgcgc       180
     aatgaaattg gcggctcggg caagggtgga aatgttgctg ctgcgcaggc cattggcaag       240
     cgtattgccg aaaaggcaaa agcagcaggt gtagaaaaag tggcgtttga tcgcgccggt       300
     tttgcgtacc atggccgcgt caaagcgctg gctgatgcgg ctcgcgaagc cggtttgcag       360
     ttctaa                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page