(data stored in ACNUC7421 zone)

EMBL: CP000529.PE333

CP000529.PE333       Location/Qualifiers
FT   CDS_pept        337339..337857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0337"
FT                   /product="SSU ribosomal protein S5P"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: ribosomal
FT                   protein S5 domain protein; Ribosomal protein S5-like; KEGG:
FT                   pol:Bpro_0492 ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35660"
FT                   /db_xref="GOA:A1VJ32"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ32"
FT                   /protein_id="ABM35660.1"
FT                   /translation="MAKFQAKSQNDAPDDGLKEKMIAINRVTKVVKGGRILGFAALTVV
FT                   GDGDGRVGMGKGKSKEVPAAVQKAMEEARRNMTKVSLKNGTLHHNVFGHHGAANVMMAP
FT                   APKGTGIIAGGPMRAVFEVMGITDIVAKSHGSSNPYNMVRATMDALKNSTTASDIAAKR
FT                   GKSVEEIFG"
     atggctaagt ttcaagctaa atcgcaaaac gacgctccag acgatggtct gaaggaaaaa        60
     atgatcgcga tcaaccgcgt gaccaaagtg gtgaagggcg gccgtattct cggttttgcc       120
     gcactcaccg tggtcggtga cggtgatggt cgcgttggca tgggcaaggg caagtcgaaa       180
     gaagtgcctg cagccgtgca aaaggccatg gaagaagcgc gccgcaacat gaccaaggtg       240
     tcattgaaaa acggcacgct gcaccacaat gtgttcggtc accacggtgc agccaacgtc       300
     atgatggcgc cggctcccaa gggtaccggc atcattgctg gcggtccgat gcgcgcagtg       360
     ttcgaagtca tgggcatcac cgacatcgtg gccaaaagcc atggttcgag caacccgtac       420
     aacatggtgc gcgccaccat ggatgcactg aaaaattcca ccacggcttc cgatatcgcg       480
     gccaagcgtg gcaaatcagt cgaagaaatc ttcggctaa                              519
//

If you have problems or comments...

PBIL Back to PBIL home page