(data stored in ACNUC7421 zone)

EMBL: CP000529.PE335

CP000529.PE335       Location/Qualifiers
FT   CDS_pept        338067..338498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0339"
FT                   /product="LSU ribosomal protein L15P"
FT                   /note="PFAM: ribosomal protein L15; KEGG: pol:Bpro_0494
FT                   ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35662"
FT                   /db_xref="GOA:A1VJ34"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ34"
FT                   /protein_id="ABM35662.1"
FT                   /translation="MELNTITPGQGAKHAKRRVGRGIGSGLGKTAGRGHKGQKSRSGGY
FT                   HKVGFEGGQMPMQRRLPKRGFKSHLLKFNAEVTLTALEQLGLAEVDLLTLKQSGLVGQI
FT                   AKNVKIINTGSLSLAVKLTGISATAGAKTIIEAAGGSIA"
     atggaattga acacaatcac gcctggccag ggcgccaaac atgccaaacg gcgtgtcggt        60
     cgcggcatcg gctctggctt gggcaaaacg gccggtcgtg gccacaaggg acaaaaatcc       120
     cgttcgggcg gctaccacaa ggtaggcttc gaaggcggtc aaatgcctat gcagcgtcgc       180
     ttgcccaagc gtggtttcaa gtcacatctg ctgaaattca atgccgaggt caccctcacg       240
     gcactggaac agctcggtct ggccgaagtg gatctgttga ccctgaagca gtctggcctt       300
     gtgggtcaga tcgccaagaa cgtcaagatc atcaacaccg gatcgctgtc attggcggtc       360
     aagctgacgg gtatttctgc tacggcaggt gccaagacca tcattgaagc cgctggcggc       420
     tccatcgctt aa                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page