(data stored in ACNUC7421 zone)

EMBL: CP000529.PE336

CP000529.PE336       Location/Qualifiers
FT   CDS_pept        338518..339825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0340"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: pol:Bpro_0495 SecY protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35663"
FT                   /db_xref="GOA:A1VJ35"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ35"
FT                   /protein_id="ABM35663.1"
FT                   /translation="MATNSAQIAKTGKFGDLRNRLVFLLLALVVYRVGAHIPVPGIDPG
FT                   QLKELFKGQQGGILNLFNMFSGGALSRFTVFALGIMPYISASIIMQLLTYVVPTFEQMK
FT                   KEGESGRRKITQYTRYGTLGLALFQSMGIAVALESSPGLVLMPGFGFRMTAVFSLTAGT
FT                   MFLMWLGEQITERGLGNGISILIFAGIAAGLPSALGGLLELVRTGAMSILIAIVIVAVV
FT                   VLVTYFVVFVERGQRKILVNYARRQVGNKVYGGQSSHLPLKLNMAGVIPPIFASSIILL
FT                   PATVVGWFSTGESMRWLKDIASTLTPGQPIYVMLYASAIIFFCFFYTALVFNSRETADN
FT                   LKKSGAFIPGIRPGDQTARYIDKILVRLTLAGAVYITFVCLLPEFLILKYNVPFYFGGT
FT                   SLMIIVVVTMDFMAQVQNYMMSQQYESLLKKANFKT"
     gtggcaacca actcggctca aattgcaaaa accggcaagt tcggcgactt gcgcaacagg        60
     cttgtgtttt tgctgctggc gctggtcgtg taccgtgtcg gtgcgcatat tccagttcca       120
     ggcattgacc ccggtcaatt gaaggagctg ttcaagggcc agcagggcgg catattgaac       180
     ttgttcaata tgttctccgg tggtgccttg tcaagattca cggtgtttgc cttgggcatc       240
     atgccctaca tctcggcttc catcatcatg cagctgctga cttatgtggt tcccacattc       300
     gagcagatga aaaaagaggg tgaatcgggc aggcgcaaga tcacgcagta cacacgttac       360
     ggaacgctag ggcttgccct gttccagtcg atgggtattg ccgttgcgct ggaaagctcg       420
     cctggtttgg tgttgatgcc tggtttcggg ttcaggatga cagcagtgtt cagtctgaca       480
     gcgggaacaa tgtttctgat gtggttgggc gagcagatta ctgagcgtgg cttgggcaac       540
     ggtatctcaa tcctgatttt tgcaggtatt gcggctggtt tgccaagtgc actcggtggt       600
     ttactggaac tggtgcgtac tggtgccatg agcatattga ttgccatcgt gatcgttgcg       660
     gttgttgtgc tggtaacgta ctttgttgtg tttgttgagc gaggtcaacg caagattctt       720
     gtgaactatg ccaggcgaca agttggtaac aaggtttatg gtggacagtc atcgcatttg       780
     cctctgaagc tgaacatggc aggcgttatt cctcccattt ttgcttcctc gattattttg       840
     ctgccagcaa cggtggtggg gtggtttagc acgggtgaaa gcatgcgctg gttgaaagac       900
     atcgccagta cgctgacgcc gggtcagccg atttatgtga tgctgtacgc cagtgcgata       960
     atctttttct gtttctttta cacagctttg gtatttaaca gccgtgaaac tgcagacaac      1020
     ctgaaaaaga gcggggcgtt cattccggga attcgtccag gtgatcagac ggcacgctac      1080
     atcgacaaga ttctggttcg cctgacattg gcaggcgcgg tttacatcac cttcgtatgt      1140
     ttgctgcccg agtttttgat tttaaagtac aacgtaccgt tttattttgg tggaacgtcg      1200
     ttgatgatta ttgttgtggt cactatggat ttcatggctc aggttcagaa ctacatgatg      1260
     tcgcagcagt atgagtcgtt gctgaaaaag gccaatttca agacgtga                   1308
//

If you have problems or comments...

PBIL Back to PBIL home page