(data stored in ACNUC7421 zone)

EMBL: CP000529.PE340

CP000529.PE340       Location/Qualifiers
FT   CDS_pept        340964..341587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0344"
FT                   /product="SSU ribosomal protein S4P"
FT                   /note="PFAM: ribosomal protein S4; RNA-binding S4 domain
FT                   protein; KEGG: pol:Bpro_0500 ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35667"
FT                   /db_xref="GOA:A1VJ39"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ39"
FT                   /protein_id="ABM35667.1"
FT                   /translation="MARYLGPKAKLSRREGTDLFLKSARRSISDKAKFDSKPGQHGRTS
FT                   GTRTSDYGLQLREKQKVKRMYGVLEKQFRRYFEEADRRRGNTGANLLSVLESRLDNVVY
FT                   RMGFGSTRAEARQLVSHKAMTVNGQSVNIPSYMVKAGDVIAVRDKSKKQTRIAEALELA
FT                   KQVGLPAWVDVNADKGEGTFKKVPDRDEFAADINESLIVELYSR"
     gtggcacgtt acctcggccc caaggccaaa ctatcacgcc gtgaaggcac cgatcttttc        60
     ctgaaaagcg cccgtcgctc gatcagcgac aaggcaaaat tcgactccaa gccaggtcag       120
     catggccgta cctccggtac gcgcacttcc gactacggtc tgcaactgcg tgaaaagcag       180
     aaagtcaagc gcatgtatgg cgttcttgaa aagcagttcc gccgctactt cgaagaagct       240
     gatcgccgcc gtggcaacac tggcgccaat ttgctgtcgg tgctggaatc gcgtctggac       300
     aatgtggttt accggatggg ttttggatcg acacgcgctg aagcgcgcca gttggtttcc       360
     cacaaggcaa tgaccgtcaa cggccagtcg gtcaatattc catcttacat ggtcaaggcc       420
     ggtgatgtga ttgccgttcg cgacaagtct aaaaagcaga cgcgcattgc tgaagcgctc       480
     gaacttgcca agcaggttgg ccttcctgcc tgggtggatg tcaatgctga caagggtgaa       540
     ggtaccttca agaaagtgcc tgatcgtgac gaatttgctg ccgacatcaa cgaatcgttg       600
     atcgtcgagt tgtactcacg ttaa                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page