(data stored in ACNUC7421 zone)

EMBL: CP000529.PE342

CP000529.PE342       Location/Qualifiers
FT   CDS_pept        342759..343160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0346"
FT                   /product="LSU ribosomal protein L17P"
FT                   /note="PFAM: ribosomal protein L17; KEGG: pol:Bpro_0502
FT                   ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35669"
FT                   /db_xref="GOA:A1VJ41"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ41"
FT                   /protein_id="ABM35669.1"
FT                   /translation="MRHGHGLRKLNRTSEHRLAMLRNMMNSLLQHEAIKTTLPKAKELR
FT                   RVVEPMITLAKTPTLANKRLAFDRLRDRDMVVKLFAELGPRYQTRPGGYTRILKMGFRV
FT                   GDNAPMALVELVDRPDVSEEIKDDAAAAK"
     atgcgacacg gacacggact acgtaaatta aaccgcacca gcgagcaccg cctcgccatg        60
     ttgcgcaaca tgatgaattc gttgctccag cacgaagcca tcaagaccac gctgccaaaa       120
     gccaaagagc tgcgccgcgt ggttgagccc atgattaccc tggcaaaaac gccaaccctg       180
     gccaacaagc gcctggcatt cgaccgtctt cgcgaccgcg acatggttgt caagctgttt       240
     gctgaactcg gcccacgcta ccagacccgt ccaggcggct acacccgtat cctgaagatg       300
     ggtttccgtg ttggcgacaa tgcgcctatg gctttggttg aactggttga tcgtcctgat       360
     gtttcggaag aaattaaaga tgacgcagca gctgcaaagt aa                          402
//

If you have problems or comments...

PBIL Back to PBIL home page