(data stored in ACNUC7421 zone)

EMBL: CP000529.PE343

CP000529.PE343       Location/Qualifiers
FT   CDS_pept        343429..343887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0347"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ret:RHE_PB00143 probable insertion sequence
FT                   transposase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35670"
FT                   /db_xref="GOA:A1VII9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1VII9"
FT                   /protein_id="ABM35670.1"
FT                   /translation="MSWRNGQAYAQDLRDRVLAAPGVLREVAERFGVSQAYVCRARARR
FT                   ERLGQTGPGAQHNHMPLRLAALEGALREQVARAPAQTLRELRQWVRAEHGIEVGTTTMF
FT                   KTLRRFGLTLKKNHPARGRANAARRRPGPPGLERQTTKPAGRSADLPR"
     atgtcgtggc gaaatggaca agcctatgca caggatttgc gcgaccgggt gctggccgcg        60
     ccaggcgtgc tgcgcgaggt cgccgagcgc tttggcgtga gccaggccta tgtctgccgg       120
     gcgcgggcac gccgcgagcg gctcggccag acgggcccgg gcgcgcagca taaccacatg       180
     ccgctgcgcc tggccgcgct ggagggcgcg ctgcgcgagc aggtcgccag agcgccggcg       240
     cagacgctgc gcgagctgcg tcagtgggtg cgtgccgagc acggcatcga ggtaggcacc       300
     accacgatgt tcaagaccct gaggcggttc gggctgacgc taaaaaaaaa tcaccctgca       360
     cgcggccgag caaacgcggc ccgacgtcgc ccaggcccgc caggactgga gcgccagaca       420
     accaagcctg ccggccgctc ggctgatctt cctcgatga                              459
//

If you have problems or comments...

PBIL Back to PBIL home page