(data stored in ACNUC7421 zone)

EMBL: CP000529.PE347

CP000529.PE347       Location/Qualifiers
FT   CDS_pept        complement(347159..347731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0351"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_4283 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35674"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ46"
FT                   /protein_id="ABM35674.1"
FT                   /translation="MASLAPQTLLFDRTALRRDQGLDRPMNSKILRLAIFLVAFSALAA
FT                   CANAQNKPESTCPPAHGMKAEQLHGRWAVRFTDPPPGLPERATMLLKRHAEFSESLAGT
FT                   VSRELGRAAGTAAIAGHSAQAALAGDLDEGMLLLDESSDNISITGTWNGEMKAGSCGQV
FT                   YQGRWKDTSRSAAPDAPEVFFTLTKLP"
     atggcctcgc tggcaccgca gactcttctt ttcgacagaa ccgccttgcg ccgcgaccaa        60
     ggccttgacc gacccatgaa ttccaaaatc ctccgactcg ctattttttt agtagcattc       120
     agcgcccttg cagcctgcgc aaatgcccaa aacaagcctg aatcaacatg cccgccggct       180
     cacggcatga aagccgaaca gctgcatggc cgctgggccg tccgctttac cgatccgccg       240
     cctggactgc ccgagcgggc cacgatgctt ctcaagcgcc acgccgaatt ctcggaaagc       300
     ttggccggca cggtcagccg cgaattgggc cgtgctgccg gcacggcggc catcgctgga       360
     cattcagccc aggccgcgct ggccggcgac cttgatgaag gcatgctgct gcttgacgaa       420
     tcgtccgaca acatcagcat caccggcacc tggaacggtg aaatgaaagc tggctcgtgc       480
     ggccaggtgt accagggccg ctggaaagat accagccgca gcgccgcgcc cgatgcgcct       540
     gaggtctttt tcacactgac aaaactgccc tga                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page