(data stored in ACNUC7421 zone)

EMBL: CP000529.PE35

CP000529.PE35        Location/Qualifiers
FT   CDS_pept        complement(34934..38545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0036"
FT                   /product="biotin carboxylation domain protein"
FT                   /note="TIGRFAM: urea amidolyase related protein; biotin
FT                   carboxylation domain protein; PFAM: biotin/lipoyl
FT                   attachment domain-containing protein; Allophanate hydrolase
FT                   subunit 2; Allophanate hydrolase subunit 1;
FT                   Carbamoyl-phosphate synthase L chain, ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   biotin carboxylase domain protein; KEGG: reu:Reut_B4883
FT                   allophanate hydrolase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35362"
FT                   /db_xref="GOA:A1VI84"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR014084"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI84"
FT                   /protein_id="ABM35362.1"
FT                   /translation="MFDTVLIANRGAIACRVIRSLKALGLRSVAVYSEADADSLHVAMA
FT                   DASVCIGPAPAAQSYLDPQRILDAARATGAGAIHPGYGFLSENPDFAQACEDAGIAFIG
FT                   PTPAQMRAFGLKHTARALAEAQGVPLLPGSGLLSDLAQARSEAARIGYPVMLKSTAGGG
FT                   GIGMRLIRNDAEMAPAFEAVQRLAQANFKDAGLFLEKFVERARHIEVQLFGDGRGQVVS
FT                   LGERDCSAQRRNQKVIEETPAPGLDEATRAALQQTAVRLAEAVHYRSAGTVEYVLDADT
FT                   GAFYFLEVNTRLQVEHGVTEQVTGVDLVAWMLRLARGDDFALQVPAPRGASIQVRLYAE
FT                   DPARNFQPCAGGLTEVVFPADARIETWVATGSEVPPHYDPMIAKLIVTGSDRADAVAKL
FT                   QAALAATRLGGIETNLRYLRSVAAGPVFVQGRMVTRSLADLHYQPQALEVLEPGVQTSV
FT                   QDHPGRVGYWAVGVPPSGPMDDLAMRLANRLVGNAEHAAALECTLSGPSLRFHHDTVIA
FT                   VCGAAMAVSVDGVALAPWQSHTVKAGSVLKLGAVQGFGARTYLALRGGLDVPLYLGSRS
FT                   TFTLGQFGGHAGRTLRTGDMLHIGTDAVAEPLAALPLDVVPVYQNHWDIAVLYGPHGAP
FT                   DFFTDDDVRMFFGTDWQVHYNSSRTGVRLIGPKPEWARRDGGEAGLHPSNIHDNAYAIG
FT                   AIDFTGDMPVILGPDGPSLGGFVCPAVVLASERWKMGQLRPGDGVRFRCVTADEALALH
FT                   AAQESRIAGLAWSPPDVPQRTEAVGSPILAQREAQGERPALVLRQAGDRYVLVELGDAV
FT                   LDIALRLRVHGLMQSLQAQQLPGIVDLTPGIRSLQIHFEPLALTVPALIAAIFIADDAL
FT                   GDTDDLVVPSRTVYLPLSWDDSATRLAIEKYMQSVRPDAPWCPSNIEFIRRINGLQSIE
FT                   EVQRTVFDASYLVLGLGDVYLGAPVATPLDPRHRLVTTKYNPARTWTPENAVGIGGAYM
FT                   CVYGMEGPGGYQFVGRTLQMWNRWRDASSGAPAFEPGKPWLLRFFDQIRFYPVGEEELL
FT                   RIRRDFPAGRYPLRVEDGTFSLHDYRAFLKENASGIAAFRALQGQAFEEERERWRVAGQ
FT                   AEYVSEAELLDAAVSADDLPPGARSVATAVPGSVWKLLVAEGDSVDEGDALLVIESMKM
FT                   EFTVFAPCAGQVLRMACREGSAVAAGQDVVVIQGETA"
     atgttcgata ccgttttgat cgccaatcgc ggcgccatcg cctgccgcgt catccgcagc        60
     ctgaaggccc tgggcctgcg ctcggtggcc gtgtattccg aggccgacgc cgattcgctg       120
     catgtcgcca tggccgacgc cagcgtctgc atcggcccgg cgccggccgc gcagagctac       180
     ctggacccgc agcgcattct ggacgcggcg cgcgccaccg gcgccggcgc catccacccc       240
     ggctacggct ttttgtccga gaacccggac ttcgcccagg cctgcgagga tgccggcatc       300
     gccttcatcg gccccacgcc cgcgcagatg cgcgccttcg gcctcaagca cacggcgcgc       360
     gcgctggccg aagcccaggg cgttcccctg ctgcccggca gcggcttgct gtctgacctg       420
     gcgcaggcgc gcagcgaggc cgcgcgcatc ggctacccgg tcatgctcaa aagcacggcg       480
     ggcggcggcg gcatcggcat gcgcctgatc cgcaatgacg ccgagatggc ccccgcgttc       540
     gaggccgtgc agcgcctggc gcaggccaac ttcaaggacg ctggcctgtt cctggaaaaa       600
     ttcgtcgagc gcgcccgcca catcgaggtg cagctgtttg gcgacggccg gggccaggtg       660
     gtgtcgctgg gcgagcgcga ttgttcggcc cagcgccgca accagaaagt gatcgaggaa       720
     acccccgcgc ccggcctcga tgaggccacc cgcgccgccc tgcagcaaac cgctgtgcgc       780
     ctggccgagg cggtccatta ccgctcggcc ggcacggtcg aatacgtgct ggacgccgac       840
     accggcgcgt tttacttcct tgaagtcaac acccgcctgc aggtcgagca cggcgtgacc       900
     gaacaggtga ccggcgtgga tctggtggcc tggatgctgc ggctggcgcg cggcgacgac       960
     ttcgcgctgc aggtgcccgc gccccggggc gcatcgatcc aggtgcggct gtacgccgaa      1020
     gacccggcac gcaactttca gccctgcgcc gggggcttga ccgaagtcgt ctttccggcc      1080
     gacgcgcgca tcgaaacctg ggtggcgacc ggcagcgaag tgccgccgca ctacgacccg      1140
     atgatcgcca agctgatcgt caccggcagc gaccgcgccg acgcggtggc gaagctgcag      1200
     gccgcgctgg cggccacccg cctgggcggc attgaaacca atctgcgtta cctgcgcagc      1260
     gtggcggccg gcccggtgtt cgtgcagggc cgcatggtca cgcgcagcct ggccgatctg      1320
     cactaccagc cgcaggcgct ggaggtgctg gagccgggcg tgcagaccag cgtgcaggac      1380
     caccccggcc gcgtcggcta ctgggcggtg ggcgtgccgc cgtcggggcc gatggacgac      1440
     ctggcgatgc gcctggcaaa ccgcctggtc ggcaacgcgg agcatgccgc cgcgctggaa      1500
     tgcacgctca gcggccccag cctgcgcttt caccacgaca ccgtgatcgc cgtgtgcggc      1560
     gcggccatgg cggtcagcgt ggacggcgtg gcgctggcgc cgtggcaatc gcacacggtg      1620
     aaagcgggca gcgtgctgaa gctgggcgcg gtgcagggct ttggcgcgcg cacctacctg      1680
     gcgctgcgcg gcgggctgga cgtgccgctc tacctgggca gccgctcgac cttcacgctg      1740
     ggccagttcg gcggccacgc gggccgcacc ttgcgcactg gcgacatgct gcacatcggc      1800
     accgatgccg tcgccgagcc tctggccgcc ttgccgctgg acgtggtgcc ggtgtaccag      1860
     aaccactggg acatcgccgt gctctacggc ccgcacggcg cgccggattt cttcaccgat      1920
     gacgatgtgc ggatgttctt tggcaccgac tggcaggtgc actacaactc cagccgcacc      1980
     ggcgttcgcc tgatcggccc caagcccgaa tgggcgcggc gcgacggcgg cgaggcaggc      2040
     ctgcacccgt ccaacatcca cgacaacgcc tatgcgattg gcgccatcga cttcaccggc      2100
     gacatgcccg tcatcctcgg gcccgacggc cccagcctgg gcggctttgt ctgcccggcc      2160
     gtggtgctgg ccagcgagcg ctggaaaatg ggccagctgc gccccggcga cggcgttcgc      2220
     tttcgctgcg tcaccgccga cgaggccctg gccctgcacg ccgcgcagga aagccgcatt      2280
     gccggtctgg cgtggagccc accggatgtg ccgcagcgca ccgaagccgt gggttcgccc      2340
     atccttgcgc agcgagaagc acaaggcgag cgcccggccc tggtgctgcg ccaggccggc      2400
     gaccgctatg tgctggtgga actgggcgac gcggtgctgg acatcgcgct gcgcctgcgc      2460
     gtgcatggcc tgatgcagtc gctgcaagcg caacagctgc ccggcatcgt cgacctgacg      2520
     cccggcatcc gctcgcttca gatacatttt gagccgctgg cgcttactgt gcctgcgttg      2580
     atagctgcga ttttcatagc agacgatgcg ctcggcgata ccgatgacct ggtcgtgccg      2640
     tcgcgcaccg tgtacctgcc gctgtcgtgg gacgacagcg cgacccggct ggcgattgaa      2700
     aaatacatgc agtcggtgcg cccggacgcg ccctggtgcc cgagcaacat cgagttcatc      2760
     cgccgcatca acggcctgca gagtattgaa gaagtgcagc gcaccgtgtt cgacgccagc      2820
     tacctggtgc tgggcctggg cgacgtgtac ctgggcgcgc ccgtggccac gccgctggac      2880
     ccgcgccacc gcctggtgac gaccaagtac aacccggccc gcacctggac gcccgagaac      2940
     gccgtgggca ttggcggcgc ctacatgtgc gtctatggca tggaaggccc cggcggctac      3000
     cagttcgtcg gccgcacgct gcagatgtgg aaccgctggc gcgatgcttc cagcggcgcc      3060
     ccagccttcg agcccggcaa gccgtggctg ctgcgctttt tcgaccagat ccgcttctac      3120
     ccggtgggcg aggaggaact gctgcggatc cgccgcgatt ttcccgccgg gcgctacccg      3180
     ctgcgcgtgg aggacggcac gttcagcctg cacgactacc gcgcgttcct gaaggagaac      3240
     gccagcggca tcgccgcctt ccgcgccctg caaggccagg cgtttgagga ggagcgcgag      3300
     cgctggcgcg tggccggcca ggccgagtac gtgagtgagg cggagttgct ggacgcggcc      3360
     gtgtccgccg acgacctgcc ccctggtgcc cgcagcgtgg cgaccgccgt gcccggcagc      3420
     gtgtggaagc tgctggtggc cgagggcgac tcggtggacg agggcgatgc cctgctggtg      3480
     atcgagtcca tgaagatgga attcaccgtg ttcgccccct gcgcgggcca ggtcttgcgc      3540
     atggcttgcc gcgaaggcag cgccgtggcg gcgggacaag acgttgtcgt gattcaagga      3600
     gaaaccgcat ga                                                          3612
//

If you have problems or comments...

PBIL Back to PBIL home page