(data stored in ACNUC7421 zone)

EMBL: CP000529.PE357

CP000529.PE357       Location/Qualifiers
FT   CDS_pept        360685..361191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35684"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ56"
FT                   /protein_id="ABM35684.1"
FT                   /translation="MKPKRLPGFTSFLCPYKKPENWRKASLQANQGNFYGQIQPQPSVY
FT                   IAWFVVSISLDASHSQPVQSFSSHVMNNSSSLRCSSCGFSVFNRRYPNCERCGAQLPQD
FT                   VAYSREEVAALRKRDMDEELARQAEKRPSPPGKSGDDSWLYFSFSGDSPDSSCSSDGGS
FT                   CSGAD"
     atgaagccaa aacgcctgcc gggtttcaca tcatttttat gcccgtataa aaaacctgaa        60
     aattggcgga aagccagtct gcaagccaat caaggaaact tttatggcca gatccaaccg       120
     cagccgtcgg tatatatcgc atggtttgtg gtatccattt cgttggatgc cagccactcg       180
     cagccggtgc aatctttctc ttcccacgtc atgaacaact cgtccagcct gaggtgttcc       240
     agttgcgggt tttccgtatt caatcgccgt taccctaatt gcgagcgttg tggcgcccaa       300
     ctgccgcagg atgtggctta ctctcgtgaa gaggtcgccg cattgcgaaa gcgggacatg       360
     gacgaggagc ttgcgcgcca ggctgaaaag cgcccgtcgc caccaggcaa gagtggcgat       420
     gatagttggc tctatttcag tttttcgggc gactccccgg acagttcctg ctcatccgac       480
     ggtggatcgt gcagcggcgc agactga                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page