(data stored in ACNUC7421 zone)

EMBL: CP000529.PE358

CP000529.PE358       Location/Qualifiers
FT   CDS_pept        complement(361263..363392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0362"
FT                   /product="primosomal protein N'"
FT                   /note="KEGG: pol:Bpro_4265 primosomal protein N'; TIGRFAM:
FT                   primosomal protein N'; PFAM: helicase domain protein; type
FT                   III restriction enzyme, res subunit; DEAD/DEAH box helicase
FT                   domain protein; SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35685"
FT                   /db_xref="GOA:A1VJ57"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ57"
FT                   /protein_id="ABM35685.1"
FT                   /translation="MSHWLQIVVATPAHSAIAGPLTYRSALLLRPGTLVRVPFGRREVL
FT                   GVVWQVLPDSGGMPEASIRDIAGVLDGLAPLSSTWRRLVAFTAGYYQRSLGEVALAALP
FT                   PQLRDLTTLQLTRRLKRTVVDTSHPQDTTDLIALSAQQACAIAEFDAETSEKQRPALLF
FT                   GATGSGKTEVYLRAAAKVLEQDPEAQVLVMVPEINLTPQLQARFEARFAHLGRERVVPM
FT                   HSGLTPAQRLKGWLAAHSGQARLVLGTRMAVFASMPNLRLLVVDEEHDPSYKQQEGARY
FT                   SARDLAVYRARLETRDREHPHGACRVLLGSATPSLESWQATIVGRYQRLNMNERIGASP
FT                   AGQPGGLPTVRRVDMNHQPKHCVIAPPLLAAIGERVARGEQSMIFLNRRGYAPVLACHD
FT                   CDWKSDCPHCSAYRVFHKIDRTLRCHHCGFTERVPRACPSCGNIDIAPVGRGTERLEEH
FT                   LAELLANVTRPDGGPVRIARIDADSTRLKGSLESQLASVHAGEVDVLVGTQMIAKGHDF
FT                   RHITLVAAINTDSALFSSDFRAPERLFSLLMQAAGRAGRDAQRSAASEMWVQTFHPDHP
FT                   LFEALKRHDYPDFAEQQLAERQAAGLSPFGFSALIRADAKTQEVAQGFLNAAAEAAQTQ
FT                   QLPGHAHVMAYPAVPMTIQRVANIERAQMLVESPSRKALQGFLAAWQPLLFETRRQAEF
FT                   KSLVRWAIDVDPIAI"
     atgagccact ggttgcagat agtggttgcc acgccggcgc acagcgccat cgccggcccg        60
     ctgacctacc gcagcgcctt gctgctgcgc cccggcacgc tggtgcgcgt tccgtttggc       120
     aggcgcgagg tgctgggcgt ggtgtggcag gtgttgccgg acagcggcgg catgcccgaa       180
     gcaagcatcc gcgacattgc cggcgtgctg gacgggctgg cgccgctgtc atcgacctgg       240
     cgccggctgg tggcctttac cgccggctat taccagcgct cgctcggcga ggtggcgctg       300
     gctgccctgc cgccgcagtt gcgcgacctc acgacgctgc agctgacgcg ccggctcaag       360
     cggacggtgg tggacaccag ccacccgcaa gacactactg atttaatagc actcagcgca       420
     cagcaggcgt gcgcaatagc cgaatttgat gctgaaacca gtgaaaaaca gcggcccgcg       480
     ctgctgtttg gcgccaccgg cagcggcaag accgaggtgt acctgcgcgc cgccgccaaa       540
     gtcctggagc aagaccccga ggcgcaggtg ctggtgatgg tgcccgagat caacctcacg       600
     ccgcagctgc aggcccggtt tgaagcgcgc tttgcccatc tgggccggga gcgcgtcgtg       660
     ccgatgcaca gcggactcac gcccgcccaa cggctcaagg gctggctggc cgcgcattcg       720
     ggccaggcgc ggctggtgct gggaacgcgc atggccgtgt tcgcgtcgat gccgaacctg       780
     cgcctgctgg tggtcgatga ggaacacgat ccgagctaca agcagcagga aggcgcgcgc       840
     tactcggcgc gcgacctggc ggtgtaccgc gcccggctgg aaacccgcga cagggagcat       900
     ccgcatggtg cctgccgcgt gctgctgggc tcagccacgc cttcgctgga aagctggcag       960
     gcgacgattg tgggccgcta ccagcgcctg aacatgaacg agcggatcgg ggccagcccg      1020
     gcaggtcagc cgggcggctt gcccacggtc aggcgggtgg acatgaacca ccagcccaag      1080
     cactgcgtca tcgcgccgcc gctgctggcg gccatcggcg agcgggtggc gcgcggcgag      1140
     cagtcgatga ttttcctgaa ccggcgcggc tatgcgccgg tgctggcctg ccacgactgc      1200
     gactggaaaa gcgactgccc gcactgcagc gcctaccgcg tgttccacaa gatcgaccgc      1260
     acgctgcgct gccaccactg cggcttcacc gaacgcgtgc cgcgcgcctg cccgagctgc      1320
     ggcaacatcg acatcgcccc ggtcgggcgc ggcaccgagc ggctcgaaga acacctggcc      1380
     gaactgctgg ccaatgtcac gcggccggac ggcggcccgg tgcgcattgc ccgcatcgac      1440
     gccgacagca cccggctcaa gggctcgctc gaatcgcagc tggccagcgt gcatgccggc      1500
     gaggtcgatg tgctggtcgg cacgcagatg atcgccaagg gccacgactt caggcacatc      1560
     acgctggtgg ccgccatcaa caccgacagc gcgctgtttt ccagcgactt ccgcgccccc      1620
     gagcggctgt tcagcctgtt gatgcaggcg gcgggccgcg ccggccgcga tgcccagcgc      1680
     agcgccgcca gcgaaatgtg ggtgcagacc tttcaccccg accatccgct gttcgaggcg      1740
     ctcaagcggc acgactaccc ggattttgcc gagcagcaac tggccgagcg gcaggcggcc      1800
     ggcctgtcgc cgttcggttt ttcagccttg atacgggccg acgccaagac ccaggaagtc      1860
     gcccagggtt tcctgaacgc cgccgccgag gccgcccaga cgcagcagct gcccggccat      1920
     gcccacgtca tggcctaccc ggccgtgccg atgacgatcc agcgcgtggc gaatatcgag      1980
     cgcgcgcaaa tgctggtcga aagcccgtcg cgcaaggcgc tgcagggctt tctggccgcc      2040
     tggcagccgc tgctgtttga aacccgcagg caggcggaat tcaaaagcct ggtgcgctgg      2100
     gcgattgacg tggacccgat tgcgatttga                                       2130
//

If you have problems or comments...

PBIL Back to PBIL home page