(data stored in ACNUC7421 zone)

EMBL: CP000529.PE36

CP000529.PE36        Location/Qualifiers
FT   CDS_pept        complement(38686..39339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0037"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: neu:NE2417 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35363"
FT                   /db_xref="InterPro:IPR017791"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI85"
FT                   /protein_id="ABM35363.1"
FT                   /translation="MSKLLESTLNPAHAVLDQTCLAGEPWMATVRAGQTLRILDLEGNQ
FT                   AVDTLFYSALDAQERYSAADTIARNGQLYLGLGSRLYSSAGRVMLSITADTCGRHDTLG
FT                   GACSSESNTVRYALDKRAMHSCRDSFMHAICHCHEAGVLGLGKRDIAPNINFFMNVPVT
FT                   PEGHLSFADGISGAGKYVELKAEMDVVVLISNCPQLNNPCNGYNPTPIRLLVWD"
     atgagcaaac tactcgaaag caccctgaat cccgcacacg ccgtgctcga ccagacctgc        60
     ctggccggcg agccgtggat ggccacggtg cgcgccgggc aaaccctgcg catcctcgac       120
     cttgaaggca accaggcggt ggacacactg ttctacagcg cgctcgatgc acaagagcgc       180
     tacagcgccg ccgacaccat cgcccgcaac ggccagctct acctgggcct gggctcacgg       240
     ctgtattcca gcgcgggccg cgtgatgctg agcatcaccg ccgacacctg cggccgccac       300
     gacaccctgg gcggcgcgtg ttcgagcgag agcaacaccg tgcgctacgc gctggacaag       360
     cgtgccatgc acagctgccg cgacagcttc atgcacgcga tttgccactg ccacgaggcg       420
     ggcgtgctgg gcctgggcaa gcgcgacatc gcacccaaca tcaacttctt catgaacgtg       480
     ccggtcacgc ccgagggcca cctgagcttt gccgacggca tctccggtgc gggcaagtac       540
     gtggaactga aggccgagat ggacgtggtg gtgctgatct ccaactgccc gcagctcaac       600
     aacccctgca acggctacaa cccgacgccg atacgcttgc tggtctggga ttaa             654
//

If you have problems or comments...

PBIL Back to PBIL home page