(data stored in ACNUC7421 zone)

EMBL: CP000529.PE361

CP000529.PE361       Location/Qualifiers
FT   CDS_pept        complement(365438..365770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35688"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ60"
FT                   /protein_id="ABM35688.1"
FT                   /translation="MDALQESCPSFGGAVIATPDGLVLVATRLFSGDTPAACAAGVVAQ
FT                   VDDCLSALKAGRVDALMMWTPGGLWFIGRLVNDHVLLLSATDSHCAGAVRLAAQVAVQK
FT                   LNAVLH"
     ttggatgcgc tgcaggagag ttgcccgtct tttggcggcg ccgtcattgc cacgccggat        60
     ggcctggtgc tggtggccac ccggctgttc agcggagaca cgcctgcggc ctgcgccgca       120
     ggcgtggtgg cacaggtgga tgattgcctg tccgcgctga aagccggacg ggtggatgcg       180
     ttgatgatgt ggacgcccgg tgggctgtgg ttcattggcc gtctggtcaa tgaccatgtg       240
     ctgctgctct cggccacgga ttcgcattgc gcaggcgccg tgcgcctggc ggcccaagtg       300
     gccgtacaaa agctcaatgc agtgctgcac taa                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page