(data stored in ACNUC7421 zone)

EMBL: CP000529.PE364

CP000529.PE364       Location/Qualifiers
FT   CDS_pept        complement(366906..367313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35691"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ63"
FT                   /protein_id="ABM35691.1"
FT                   /translation="MSALDNALQKAVTSIPECVAAGYVDLSSGMILSMKSVDSHPGEVF
FT                   DLLAAATTDLFQGPNVSAIENIFRKARGLPDNNEHHYFQEIIVNSDNLIHVFLRGKRQQ
FT                   QVACFVCRKGANLGMVLTKSRMAMPTIESSL"
     atgagcgctc ttgacaatgc actgcaaaaa gcagtcacca gcattccgga atgcgtagcc        60
     gcaggctatg tggacttgtc ctccggcatg attctgagca tgaaatccgt ggattcgcac       120
     ccgggcgaag tgttcgactt gctggccgcc gcgacgaccg acctgttcca gggccccaac       180
     gtgtcggcga ttgaaaatat tttccgcaaa gcccgtggcc tgcccgacaa caatgagcat       240
     cactacttcc aggaaatcat cgtcaacagc gacaacctga tccatgtgtt cctgcgcggc       300
     aaacgccagc agcaggtggc ctgctttgtc tgccgcaagg gcgccaacct gggcatggtg       360
     ctgaccaagt cgcgcatggc catgcccacc atcgaatcgt ctctttaa                    408
//

If you have problems or comments...

PBIL Back to PBIL home page