(data stored in ACNUC7421 zone)

EMBL: CP000529.PE366

CP000529.PE366       Location/Qualifiers
FT   CDS_pept        complement(368774..369337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0370"
FT                   /product="protein of unknown function, ATP binding protein"
FT                   /note="PFAM: protein of unknown function, ATP binding;
FT                   KEGG: noc:Noc_0133 conserved hypothetical ATP binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35693"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ65"
FT                   /protein_id="ABM35693.1"
FT                   /translation="MGPVGSGKTEAIKSISDIEVINTDVRATDDVRKLKSHTTVSMDVG
FT                   VLHLSGHDKLRLYGAPGQDRFDFMWDILLLQAKGVALLLNHASADPLAELDHYLQAIRE
FT                   RAPGNGLPMVIGITHIDEKPERPLSIYEDHLRQEKIVFYGVMPPVIEVDARLRSHVRSL
FT                   LLVMVAQLEMAARFPKVIPRLAAR"
     atgggacctg tgggctcggg taagaccgag gccatcaaaa gcatttcgga tattgaagtg        60
     atcaataccg atgtgcgcgc cactgacgat gtgcgcaagc tcaaatccca caccaccgtg       120
     tcgatggatg tcggggttct gcatttgtca ggccatgaca agctgcggct gtatggcgcg       180
     ccggggcaag accggtttga cttcatgtgg gacattttgc tgctgcaggc caaaggggtc       240
     gcgctgctgc tgaaccacgc cagtgcagac ccgctggctg aactcgatca ttacctccag       300
     gccatccgtg agcgcgctcc tggaaatggc ctgcccatgg tcatcgggat cacgcacatt       360
     gacgagaaac ccgagcggcc cttgagcatt tacgaggacc acctgcgcca ggaaaaaatt       420
     gtgttttacg gtgtcatgcc gcctgtgatc gaggtggatg cacgccttcg cagccatgtc       480
     cgcagcttgt tgctggtcat ggtggcgcag ctggagatgg cggcgcgctt tcccaaagtg       540
     attcctcggc tggcagcgcg atga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page