(data stored in ACNUC7421 zone)

EMBL: CP000529.PE371

CP000529.PE371       Location/Qualifiers
FT   CDS_pept        complement(372909..373373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0375"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; KEGG:
FT                   pol:Bpro_4258 CoA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35698"
FT                   /db_xref="GOA:A1VJ70"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ70"
FT                   /protein_id="ABM35698.1"
FT                   /translation="MQHLPAAERIPYILNHCRTIAVVGLSPKPHRASFDVARYMQAAGY
FT                   RIIPVNPNAAEVLGEKAYATLQEAARHEKIDLVNCFRNSEDIPPIVDEAIAIGARAVWM
FT                   QLGIAHPEAAARAEAAGLLVVQDHCIKIDHRVLMSSGLLKPLAQPAAPAR"
     atgcagcacc ttcccgccgc tgaacgcatt ccctacatcc tcaaccattg ccgcaccatc        60
     gccgtggtcg gcctgtcgcc caagccgcac cgggccagct ttgacgtggc gcgctacatg       120
     caggccgccg gctaccgcat cattccggtc aacccgaatg ccgccgaggt gctgggcgaa       180
     aaagcctatg ccacgctgca ggaagcggcc cggcacgaaa aaatcgacct ggtgaactgc       240
     ttcaggaaca gcgaagacat tccgcccatc gtcgatgagg ccatcgccat cggcgccagg       300
     gcggtgtgga tgcaactggg catcgcccac cccgaagccg ccgccagggc tgaagccgcc       360
     ggcctgctgg tggtgcagga ccactgcatc aagattgacc accgagtgct gatgtccagc       420
     ggcctgctca agccgctggc gcagccggcc gcgccagcgc gctga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page