(data stored in ACNUC7421 zone)

EMBL: CP000529.PE373

CP000529.PE373       Location/Qualifiers
FT   CDS_pept        375774..376268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0377"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   plu:plu2740 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35700"
FT                   /db_xref="GOA:A1VJ72"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ72"
FT                   /protein_id="ABM35700.1"
FT                   /translation="MHKMRNTMPAPPLAISNAMATRLGALGQQIRTRRKALRLSATVAA
FT                   EAAGLSRVTLHRMEKGAPAVTMAAYLNVMAALGLDFSLSLPADPAAVAPAADHTGWIPA
FT                   RVRLGDYPQLKQLAWHVQGVDELTPAEALSIYERNWRHIDVAALQPHEQQLVDALRLAL
FT                   T"
     atgcataaaa tgagaaacac tatgccagca ccaccccttg ccatctcaaa cgccatggcc        60
     acccgattgg gtgcgctggg gcagcagatt cgtacccgcc gcaaggcact taggctcagc       120
     gccacggtgg ctgcagaggc ggctggcctg tcgcgcgtga ctttgcaccg catggaaaag       180
     ggcgcgcccg ccgtcaccat ggcggcctac ctgaacgtca tggcagcgct ggggctggac       240
     ttcagcctga gcctgccagc cgaccccgcc gccgttgcgc ctgccgccga tcacaccggc       300
     tggattccgg cgcgcgtgcg cctgggtgat tacccgcagc tcaagcaact cgcctggcat       360
     gtgcagggcg tggatgaact gacaccggcc gaggcgctca gcatttatga gcgcaactgg       420
     cgccatatcg acgtggcagc gctgcagccg catgagcaac agctggtcga tgccttgcgc       480
     ctggccctga catga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page